triangle PDBeMotif: 2l35  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification protein binding    | release date: Mon, Sep 6, 2010
Title structure of the dap12-nkg2c transmembrane heterotrimer
Authors J.J.CHOU, K.W.WUCHERPFENNIG, M.E.CALL
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
Chain B sequence:
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| |  |  || || |     | |   |  |||  |       | | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *********** |  ***** || |     | |   *****|  |       | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..      **********  *********** |     | |   **** ****       | | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           |  |     | |                   | ***
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |     ***                   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                           ***  

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ^*****    |  || |  || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |*****    ***** ********  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *********    ****  *******   

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||   | |  || ||||     | |   | ||||| |      |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      **********   | *********|     | |   *****|| |      |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *********|   | **********     | |   *********      |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..               |   |                ***     |   |        |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..               |   |                        |   |        ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****                        *****              

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||| ^*****          |  |||||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |*********          ********| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |********           ********* 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |                           
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                           

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| |  |  || || |         | |||||||   |    |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ********** |  ***** || |         *******||   |    |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ********************** |         ********|   |    ****  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                 |   |    ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                *****          

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||| ^*****      |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||| |*****      |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |********       ****          
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                           

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| || || ||  || ||||     | |   | ||||| |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ********** *************|     | |   ******* |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *************************     | |   *********            
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |     ***                        
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                                

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||| ^*****|   |  || |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |**********   ***** *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |*********    ****  ****      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |                           
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                           

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| ||||| |||||||  | || |        |  |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ************************|  | || |        |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *********************** |  | || |        ****            
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |  ******                        
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                                

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||  ^*****|  |  || ||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||  |******  |  *********     
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |*********   |  ********      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***            |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****            

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****|  || ||||| ||| ||| |   | |   | ||||| |       | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ************************| |   | |   *****|| |       | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ************************| |   | |   *********       | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              ***   | |     |   |         | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                    ***     |   |         | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                            |   |         ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *****              

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ^*****|  || || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |*******************         
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ********************         

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| ||||  || ||||     | |    || |||| ||    |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ************************|     | |    |*********    |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *********************** |     | |    **********    ****  
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |     ***                  |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                          ****  

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ^*****|     |  ||  ||  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |******     |  |********* 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *********      ************  

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||  |  |  || || |  | || |   | ||| |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ******* ||  |  ***** || |  | || |   ***** |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *************************  | || |   ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  nest ..                                 ******     |   |        |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                            |   |        ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *****              

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ^*****|  || || ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |********** *****  ****** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ******** ****  ****   *****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****            

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| ||||     |  |  | || ||  ||||| |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ***************|     |  |  | || |******** |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****************     ****  | || |**********              
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |  ******     |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****             |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *****              

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |||| ^*****      |  ||  |||  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |||| |*****      |  |*****|  | 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||********       ******** **** 
search RasMol script viewer Motif-ligand binding stats  nest .. ****                           

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||| || |  ||  ||      | ||  |||  |  |  |    | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      **********| || *********      | |*****|  |  |  |    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ***********************       | |**** ****  ****    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                    ***                   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                          ***  

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||  ^*****|  ||  || |  || ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||  |************** ********* 
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |*****************  ********  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                             

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****|     |  || ||||||| || || |  || |  || |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *******     |  |********| || || ***** |  || |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ******      ************* || || ****  |  ****            
search RasMol script viewer Motif-ligand binding stats  nest ..                              *********     |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *****              

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||  ^*****|     |  ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |**********     *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |**** ****      ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                             

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| ||||| ||| ||  |     | |  || ||| |||  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ***********|********  |     | |  || |******  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********** ************     | |  *************           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                  ***                          

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||| ^*****|         |  |||||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||| |******         ********* 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |*********          ********* 
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                           

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****|  || ||||  || ||||     | |     |   |  ||  | |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *******  |**************|     | |     |   |  ||  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ******   ****************     | |     |   ******** |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |     ***     |   |   |    |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****             |   |   |    ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *********          

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ^*****|  ||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  | *********  ********     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** ********   *******      

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****|  || ||||  || ||||     | ||  |||  || | |  | |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *******  |**************|     | |*****|  || | |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ******   ************** |     ******* ******* **** |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |     ***     |   |   |    |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****             |   |   |    ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *********          

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |||| ^*****|         |  ||  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |||| |******         ********* 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||*********          ********  
search RasMol script viewer Motif-ligand binding stats  nest .. ****                           

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DAP12-NKG2C_TM
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
seq num:  ..1         11        21        31        41        51        61 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ^*****| |||||| || ||||| |       |   | ||||| | |    |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ************** ******|| |       |   *****|| | |    |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *********************** |       |   **** **** |    |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****       |   | |   |   |    ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ***** *********          

chain B : TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN
member of: PANTHER:searchPTHR17554UniProt:searchO43914
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ^*****|  || |||||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |**************|*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ***********************      

   New search    2l35:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML