triangle PDBeMotif: 2k7w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification apoptosis    | release date: Wed, Aug 27, 2008
Title bax activation is initiated at a novel interaction site
Authors E.GAVATHIOTIS, E.H.CHENG, G.H.BIRD, H.C.TU, H.KIM, K.PITTER, L.D.WALENSKY, M.L.DAVIS, M.SUZUKI, N.TJANDRA, S.G.KATZ
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Chain B sequence:
EIWIAQELRRIGDEFNAYYA
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| || ||||   || ||| |||  |     |  || |         | || | ||**^*|| ||||||| |||| ||||| |   |||||||| || |||| | ||||||  |||||||| |||||||      || ||||| ||  | ||  |||  ||||||   |||||||||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| || ||||   || ||| |||  |     |  || |         | || | ^**||||| ||||||| |||| ||||| |   ^**||||| || |||| | ||||||  |||||||| |||||||      || ||||| ||  | ||  |||  ||||||   |||||||||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| || ||||   ^***|| |||  |     |  || |         | || | |||||||| ||||||| ^*** ||||| |   ^***|||| || |||| | ||||||  |||||||| |||||||      || ||||| ||  | ||  |||  ||||||   |||||||||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| || |||^*****  || |||  |     |  || |         | || | |||||||| |||||||  ||| ||||| |   || ||||| || |||| | ||||||  |||||||| |||||||      || ||||| ||  | ||  |^*****||||   ||||||||||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|| || ||||       || |||  |     |  || |         | || | |||||||| |||||||  ||| ||||| |   || ||||| || ********************||| |||||||      || ||||| ||  | ||  | |  ||||||   |||||||||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|| || ||||       || |||  |     |  || |         | || | |||||||| |||||||  ||| ||||| |   || ||||| ||  ||| | ||||||  |||||||| |||||||      || ||||| ||  | ************|||   |||||||||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|| || ||||       || |||  |     |  || |         | || | ||||***************|| ||||| |   || ||||| ||  ||| | ||||||  |||||||| |||||||      || ||||| ||  |  |  | |  ||||||   |||||||||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|| || ||||       ******  |     ***** |         | || | ****************  ||******* |   ***************| | |||||******************|      |**********  |  |  | |  ******   ||*****************|    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| || ||||       || |||  |     |  |  |         ***| | |||| ||| |||||||  ||| || |  |   || || || ||  | | | ***|||  | |||| | || || |      || || || ||  |  |  | |  ||||||   |||||| ||||| || || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****| ||||       *********     *******            | | ****************  |**********   ************** | | |********************* |      |**********  ****  | |  *****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  | ****                                        | |  |   |         |  |      |  |                  | | ||||    |   |    |   | |      |   |              | |    |  |   |||  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                                             | |  |   |         |  |      |  |                  *** ****    |   |    |   ***      |   |              ***    |  |   ***  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                             ***  |   |         ****      ****                              |   |    |   |        |   |              ***    ****    |   |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****    *****        *****                             *****   *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     **********     
search RasMol script viewer Motif-ligand binding stats  betaturn ..     *********      

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |   | |   || ||| |||  || ||||  || |            | | ||**^*|  || ||||||| |  ||||||   | |||||| || ||||||  |  | | |||||||||||||||| ||| |||||||||| || ||||| |||  ||||||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |   | |   || ||| |||  || ||||  || |            | | ^**||||  || ||||||| |  ||||||   ^**||||| || ||||||  |  | | |||||||||||||||| ||| |||||||||| || ||||| |||  ||||||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |   | |   ^***|| |||  || ||||  || |            | | |||||||  || |||||^***  ||||||   ^***|||| || ||||||  |  | | |||||||||||||||| ||| |||||||||| || ||||| |||  ||||||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |   | ^*****  || |||  || ||||  || |            | | |||||||  || |||||||    ||||||   | |||||| || ||||||  |  | | |||||||||||||||| ||| |||||||||| || ||||| |^*****||||   | | || |||^*****|||     
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |   | |       || |||  || ||||  || |            | | |||||||  || |||||||    ||||||   | |||||| || ********************||||||||||| ||| |||||||||| || ||||| |||  ||||||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |   | |       || |||  || ||||  || |            | | |||||||  || |||||||    ||||||   | |||||| ||  |||||  |  | | |||||||||||||||| ||| |||||||||| || ||************|||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |   | |       || |||  || ||||  || |            | | ||||***************    ||||||   | |||||| ||  |||||  |  | | |||||||||||||||| ||| |||||||||| || || || |||  ||||||   | | || ||||||||||||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |   | |       |*****  |********** |            | | ||********* |||||||    ||||||   *****|*********|||  |  | *****|*******||||| |**********||| || ***** |||  |*****   | | ***************     
search RasMol script viewer Motif-ligand binding stats  betaturn ..****   | |       *****   ***** *******            | | ******************|    *****|   *****************|  **** *****************| |**************** ********|  *****|   | | **************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***                                        | |                |  |      |  |                  | |         |   |    |   | | |   ||   |           |  | |    |  |   | |      |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |                |  |      |  |                  ***         |   |    |   *** |   ||   |           |  ***    |  |   ***      |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                ****      ****                              |   |    |   |   |   ||   |           |    |    ****            |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                 |   |    |   |   |   ||   |           ******                    |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                 *****    *****   **********                                     *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    || ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |*********  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    *************   

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||    |   || ||   |  || |  ||| || |         | || | ||**^*|  ||  ||| || |  |||  | | | ||| |||||||||| | |||||   | |||||||||| |||       | |||| |  | | ||| |||  ||||||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||    |   || ||   |  || |  ||| || |         | || | ^**||||  ||  ||| || |  |||  | | ^**|| |||||||||| | |||||   | |||||||||| |||       | |||| |  | | ||| |||  ||||||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ||    |   ^***|   |  || |  ||| || |         | || | |||||||  ||  ||| ^***  |||  | | ^***| |||||||||| | |||||   | |||||||||| |||       | |||| |  | | ||| |||  ||||||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||    ^*****  |   |  || |  ||| || |         | || | |||||||  ||  ||| || |  |||  | | |   | |||||||||| | |||||   | |||||||||| |||       | |||| |  | | ||| |^*****||||   | |||  |||^*****||||| | 
search RasMol script viewer Motif-ligand binding stats  BH1 ..|| ||            |   |  || |  ||| || |         | || | |||||||  ||  ||| || |  |||  | | |   | ||||||********************||||||| |||       | |||| |  | | ||| |||  ||||||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  BH2 ..|| ||            |   |  || |  ||| || |         | || | |||||||  ||  ||| || |  |||  | | |   | |||||| ||| | |||||   | |||||||||| |||       | |||| |  | | ************|||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  BH3 ..|| ||            |   |  || |  ||| || |         | || | ||||*************** |  |||  | | |   | |||||| ||| | |||||   | |||||||||| |||       | |||| |  | |  || |||  ||||||   | |||  ||||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****            |   ***** *****| || |         | || | ***************| || *****|  | | |   ***********| | |||||   | *************|       *****| |  | |  || |||  |*****   | ||***********|***** | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||            |   |  |  |  ||| || |         ***| ***||||||  ||  ||| || |  | |  | | |   | || ||  | | | ***||   | |||||||||  | |       | || | |  | |  || |||  ||||||   | |||  | ||| |||||||| | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..*****            |   ****  ***********            | | ******************| **** |  | | |   ********** | | |****   ************** |       ****** **** ********|  *****|   ********************| | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   |                            | |                |  |      |  | | |              | | ||||    |   |    |   | |                      |  | |    |  |   | |      |   |   |  *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |                |  |      |  | | |              *** ****    |   |    |   ***                      |  ***    |  |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***                ****      **** ***                          |   |    |   |                        |    |    ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                           |   |    |   |                        ******                    |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****    *****                                                  *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  ||  |********^| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *********  ******* 
search RasMol script viewer Motif-ligand binding stats  betaturn .. *****************  

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |     |   || |||  ||  ||    |  |  |         | |    | **^*||||  || |||||| ||||  |   ||||||||||| || | |  |  || || |||  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| |||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |     |   || |||  ||  ||    |  |  |         | |    ^**|||||||  || |||||| ||||  |   ^**|||||||| || | |  |  || || |||  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| |||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |     |   ^***||  ||  ||    |  |  |         | |    |  |||||||  || ||^*** ||||  |   ^***||||||| || | |  |  || || |||  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| |||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |     ^*****  ||  ||  ||    |  |  |         | |    |  |||||||  || || ||| ||||  |    | |||||||| || | |  |  || || |||  | ||| ||| ||  || ||||||  |   ||||||^*****|||| | ||||| ||||^*****|| |    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |             ||  ||  ||    |  |  |         | |    |  |||||||  || || ||| ||||  |    | |||||||| ********************  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| ||||||||| || |    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |             ||  ||  ||    |  |  |         | |    |  |||||||  || || ||| ||||  |    | ||||||||  | | |  |  || || |||  | ||| ||| ||  || ||||||  |   |************||| | ||||| ||||||||| || |    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |             ||  ||  ||    |  |  |         | |    |  |***************|| ||||  |    | ||||||||  | | |  |  || || |||  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| ||||||||| || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |             |*********    |  |  |         | |    ********||  || || ||*****|  |    **********  | | |  ***** *****|  | |*****| |***** ||||||  |   |*****||  ****** | |||************ || |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |             ||  ||  |     |  |  |         ***    |  |||||||  || || ||| || |  |    | || || ||  | | |  |  |  || |||  | ||| ||| ||  || ||||||  |   ||||||||  |||||| | ||||| |||||| || || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****             |********     *******                ***************** |***** |  |    ************* | |  ****  ********* |*****| |****| *********   *******|  *****| ****|*****************    
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                                               |  |      |  |                  ***         |   |    |   *** |   ||   |           |  ***    |  |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                               ****      ****                              |   |    |   |   |   ||   |           |  ***    ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                           |   |    |   |   |   ||   |           ******                    |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****    *****   **********                                     *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || || ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || || |*****|| ||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. *****************  

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  | ||   |||| ||  |  |  |  | || ||            | | ||**^*|||||||  |||| |  ||| ||   | ||| |||||||| | |  |  |  || |||||||||  |||      || |||||  |  | ||| |||   || ||   ||| || ||||| ||||  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | ||   |||| ||  |  |  |  | || ||            | | ^**||||||||||  |||| |  ||| ||   ^**|| |||||||| | |  |  |  || |||||||||  |||      || |||||  |  | ||| |||   || ||   ||| || ||||| ||||  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  | ||   ^*** ||  |  |  |  | || ||            | | || ||||||||||  ||^***  ||| ||   ^***| |||||||| | |  |  |  || |||||||||  |||      || |||||  |  | ||| |||   || ||   ||| || ||||| ||||  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |^*****|  ||  |  |  |  | || ||            | | || ||||||||||  || | |  ||| ||   |  || |||||||| | |  |  |  || |||||||||  |||      || |||||  |  | ||| |^*****| ||   ||| || |||^*****|  ||   
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |  | |      |  ||  |  |  |  | || ||            | | || ||||||||||  || | |  ||| ||   |  || ||||||********************||||||  |||      || |||||  |  | ||| |||   || ||   ||| || ||||| || |  ||   
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |  | |      |  ||  |  |  |  | || ||            | | || ||||||||||  || | |  ||| ||   |  || |||||||| | |  |  |  || |||||||||  |||      || |||||  |  | ************ ||   ||| || ||||| || |  ||   
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |  | |      |  ||  |  |  |  | || ||            | | || |*************** |  ||| ||   |  || |||||||| | |  |  |  || |||||||||  |||      || |||||  |  |  || |||   || ||   ||| || ||||| || |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  | |      *****  |  |  |  | || ||            | | ***************** | *****| ||   *************| | |  |  |  ****************|      |*****||  |  ***** |||   *****   ||| ******** || *****   
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  | |      |  |   |  |  |  | || ||            | ***| |||| || ||  |  | |  ||| ||   |  || |||||| | | |  |  |  || |||||||||  | |      || || ||  |  |  || |||   || ||   ||| || ||||| || |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  | |      ****   ****************            | | ****************  | ********|   ************** | |  ****  *************** |      |**********  ********|   ****|   ||| *********** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                         | |  |   |         |  |      |  |                  | |         |   |        | |      |   |              | |    |  |   |||  |   |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |  |   |         |  |      |  |                  ***         |   |        ***      |   |              ***    |  |   ***  |   |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***  |   |         ****      ****                              |   |                 |   |                     ****    |   |   |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****                 *****                             *****   *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | || ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | || ||*****      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ************      

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  ||  | |   || |||  ||  |     |  ||  |           | | ||**^*|| ||||||| || | |||||||   | ||| || ||||| | |       | ||||| |||||||| |      || |||||| ||   ||| ||| |||||||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  ||  | |   || |||  ||  |     |  ||  |           | | ^**||||| ||||||| || | |||||||   ^**|| || ||||| | |       | ||||| |||||||| |      || |||||| ||   ||| ||| |||||||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ||  | |   ^***||  ||  |     |  ||  |           | | |||||||| ||||||| ^*** |||||||   ^***| || ||||| | |       | ||||| |||||||| |      || |||||| ||   ||| ||| |||||||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  ||  | ^*****  ||  ||  |     |  ||  |           | | |||||||| ||||||| || | |||||||       | || ||||| | |       | ||||| |||||||| |      || |||||| ||   ||| |^*****||||   | | ||||||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  ||  | |       ||  ||  |     |  ||  |           | | |||||||| ||||||| || | |||||||       | || |||******************** |||||||| |      || |||||| ||   ||| ||| |||||||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  ||  | |       ||  ||  |     |  ||  |           | | |||||||| ||||||| || | |||||||       | || ||| | | |       | ||||| |||||||| |      || |||||| ||   ************|||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  ||  | |       ||  ||  |     |  ||  |           | | ||||*************** | |||||||       | || ||| | | |       | ||||| |||||||| |      || |||||| ||    || ||| |||||||   | | ||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****  | |       |*****  |     |  ||  |           | | **************** || *********       | ****** | | |       *****|*********| |      |*****||| ||    || ||| ||*****   | ***********|*****|    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****   | |       |********     ********           | | ***************| || ********|       ********** | |       **************** |      |***********    |****| |*****|   | ******************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***       |   |                            | |              | | ||      |  |                  | |         |   |    |   | |      |   |           |  | | |  || |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |              | | ||      |  |                  ***         |   |    |   ***      |   |           |  *** |  || |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***              | ****      ****                              |   |    |   |        |   |           |  *** |  ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                             |   |                                         |   |    |   |        |   |           ****** |   |              |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                             *****                                         *****    *****        *****                  *****              *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |||||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ||*********     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    **********      

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |   | |   || | |  ||  |  |  || ||              | | ||**^*||||     | || |    |  |   |||||||| ||||| | | |     |||||||  ||||||||| ||| ||| |||| |  | ||||||||| ||||||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |   | |   || | |  ||  |  |  || ||              | | ^**|||||||     | || |    |  |   ^**||||| ||||| | | |     |||||||  ||||||||| ||| ||| |||| |  | ||||||||| ||||||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |   | |   ^*** |  ||  |  |  || ||              | | || |||||||     | ^***    |  |   ^***|||| ||||| | | |     |||||||  ||||||||| ||| ||| |||| |  | ||||||||| ||||||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |   | ^*****   |  ||  |  |  || ||              | | || |||||||     |  |      |  |   |||||||| ||||| | | |     |||||||  ||||||||| ||| ||| |||| |  | |||||||^*****|||| | |||||  |||^***** ||     
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |   | |        |  ||  |  |  || ||              | | || |||||||     |  |      |  |   |||||||| |||********************  ||||||||| ||| ||| |||| |  | ||||||| | ||||||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |   | |        |  ||  |  |  || ||              | | || |||||||     |  |      |  |   |||||||| ||| | | | |     |||||||  ||||||||| ||| ||| |||| |  | ||************||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |   | |        |  ||  |  |  || ||              | | || |***************      |  |   |||||||| ||| | | | |     |||||||  ||||||||| ||| ||| |||| |  | ||||||| | ||||||| | |||||  ||||||||| ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |   | |        |  ||  |  |  || ||              | | ********||     |  |      |  |   *****|****** | | | |     *****|********|||| |**********| |  | ||||||| | ||||||| | ||||********||*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..****   | |        ********  ********              | | **********     |  |      |  |   ************** | | |     *****************| |*********** **** ******| | ******| ********************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***                                        | |  |   |         |  |      |  |                  | ***       |   |    |   | | |   ||   |              | | |  || |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |  |   |         |  |      |  |                  ***         |   |    |   *** |   ||   |              *** |  || |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***  |   |         ****      ****                              |   |    |   |   |   ||   |                  |  ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****    *****   **********                  *****              *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || |||||********^||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *******************
search RasMol script viewer Motif-ligand binding stats  betaturn .. ************* **** 

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| || ||||   |||| |||||||  |  ||  || ||               ||**^*|| ||||||| || |  |||  |   | || ||  || || |||  |  | |||||||||||||||||| ||  ||| ||||| ||  ||||||||| ||||||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| || ||||   |||| |||||||  |  ||  || ||               ^**||||| ||||||| || |  |||  |   ^**| ||  || || |||  |  | |||||||||||||||||| ||  ||| ||||| ||  ||||||||| ||||||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| || ||||   ^*** |||||||  |  ||  || ||               |||||||| ||||||| ^***  |||  |   ^*** ||  || || |||  |  | |||||||||||||||||| ||  ||| ||||| ||  ||||||||| ||||||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| || |||^*****|  |||||||  |  ||  || ||               |||||||| |||||||  | |  |||  |     |  ||  || || |||  |  | |||||||||||||||||| ||  ||| ||||| ||  |||||||^*****|||| | ||||| ||||^*****|||  | |
search RasMol script viewer Motif-ligand binding stats  BH1 ..|| || ||||     |  |||||||  |  ||  || ||               |||||||| |||||||  | |  |||  |     |  ||  || ********************||||||||||| ||  ||| ||||| ||  ||||||| | ||||||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  BH2 ..|| || ||||     |  |||||||  |  ||  || ||               |||||||| |||||||  | |  |||  |     |  ||  ||  | |||  |  | |||||||||||||||||| ||  ||| ||||| ||  ||************||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  BH3 ..|| || ||||     |  |||||||  |  ||  || ||               ||||*************** |  |||  |     |  ||  ||  | |||  |  | |||||||||||||||||| ||  ||| ||||| ||  || |||| | ||||||| | ||||| |||||||||||||  | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|| || ||||     |  *******  |  ||  || ||               ****************  | *****|  |     |  |*****  | |||  |  | ***************||| ||  ||**********  |*****| | |****** | ||||***************  | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..****| ||||     *********   ************               ****************  | **** |  |     ***************|  **** *****************| |****|**********  ***** | | |*****| ****|***************   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  | ****                                             |   |         |  |      |  |                  | |         |   |    ||  | | |   ||   |              | | |  || |   | |      |   |       ***
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                                                  |   |         |  |      |  |                  ***         |   |    ||  *** |   ||   |              *** |  || |   ***      |   |          
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                                  |   |         ****      ****                              |   |    ||  | | |   ||   |                  |  ****            |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                       |   |                                                     |   |    |****** |   ||   |                  |   |              |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****    *****   **********                  *****              *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || || ||********^| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ****************** 
search RasMol script viewer Motif-ligand binding stats  betaturn .. *****************  

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |   | |   || |||  ||  || || |  |  |   | |   | || | ||**^*||    |||| || | ||||| |   |||||||| || || ||| ||||||| |||||||||||  | |  |||||||||||  ||  | || ||||  ||||||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |   | |   || |||  ||  || || |  |  |   | |   | || | ^**|||||    |||| || | ||||| |   ^**||||| || || ||| ||||||| |||||||||||  | |  |||||||||||  ||  | || ||||  ||||||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |   | |   ^***||  ||  || || |  |  |   | |   | || | ||||||||    |||| ^*** ||||| |   ^***|||| || || ||| ||||||| |||||||||||  | |  |||||||||||  ||  | || ||||  ||||||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |   | ^*****  ||  ||  || || |  |  |   | |   | || | ||||||||    |||| || | ||||| |   || ||||| || || ||| ||||||| |||||||||||  | |  |||||||||||  ||  | || ||^*****||||   |||| |||||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |   | |       ||  ||  || || |  |  |   | |   | || | ||||||||    |||| || | ||||| |   || ||||| || ********************||||||  | |  |||||||||||  ||  | || || |  ||||||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |   | |       ||  ||  || || |  |  |   | |   | || | ||||||||    |||| || | ||||| |   || ||||| ||  | ||| ||||||| |||||||||||  | |  |||||||||||  ||  | ************|||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |   | |       ||  ||  || || |  |  |   | |   | || | ||||*************** | ||||| |   || ||||| ||  | ||| ||||||| |||||||||||  | |  |||||||||||  ||  | || || |  ||||||   |||| |||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |   | |       |*****  || || |  |  |   | |   | || | ********    |||| || ******* |   ***********  | ||| |||||******|||*****  | |  ***************  | || || |  ******   ||*****************|    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |   | |       ||  ||  || || |  |  |   | |   ***| | |||| ||     |||| || | || |  |   || || || ||  | ||| ***|||| || ||||||||  | |  |||||| || |  |   | || || |  ||||||   |||| ||||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****   | |       |************ *******   | |      | | *******     ******| ******  |   *****************| |********************* |  **************   ******| |  *****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***       |   |                   ***      | |  |   |       | | ||      |  |                  | | ||||    |   |        | |      |   |              | |    |  |   |||  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |  |   |       | | ||      |  |                  *** ****    |   |        ***      |   |              ***    |  |   ***  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***  |   |       | ****      ****                              |   |                 |   |                     ****    |   |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                 *****       *****                                         *****                 *****                             *****   *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |   |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |   |******     
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****   ******      

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |   | |   || |||  || || || ||  |  |   | |      | | ||**^*||||||||||||||| |||||||   | ||  |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  | ||  ||| ||||||    | ||| |||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |   | |   || |||  || || || ||  |  |   | |      | | ^**|||||||||||||||||| |||||||   ^**|  |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  | ||  ||| ||||||    | ||| |||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |   | |   ^***||  || || || ||  |  |   | |      | | |||||||||||||||||^*** |||||||   ^***  |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  | ||  ||| ||||||    | ||| |||||| |||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |   | ^*****  ||  || || || ||  |  |   | |      | | ||||||||||||||||| ||| |||||||         |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  | ||  |^*****|||    | ||| ||||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |   | |       ||  || || || ||  |  |   | |      | | ||||||||||||||||| ||| |||||||         ||||||********************   || | |||   | |||||||||  |  | ||  | | ||||||    | ||| |||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |   | |       ||  || || || ||  |  |   | |      | | ||||||||||||||||| ||| |||||||         |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  | ************||    | ||| |||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |   | |       ||  || || || ||  |  |   | |      | | ||||***************|| |||||||         |||||||| | |  |  ||| |||||   || | |||   | |||||||||  |  |  |  | | ||| ||    | ||| |||||| || ||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |   | |       |******** || ||  |  |   | |      | | ****************| ||*******||         *******| | |  |  ||*****||   || | |||   *********||  |  |  |  | | ||| ||    | |****************|    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |   | |       ||  |  |  || ||  |  |   | |      | ***|||||| ||||||||| ||| |||||||         |||||| | | |  |  ||| || ||   || | |||   | |||||||||  |  |  |  | | ||| ||    | ||| || ||| || || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****   | |       |*******  ***********   | |      | | ***************** |**********         ******** | |  ***********|   *******|   **************  ****  | | |*****    | |*****************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***       |   |                   ***      | |                |  |      |  |                  | |         |   |    |   | |                         | | |   |     | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |                |  |      |  |                  ***         |   |    |   ***                         *** |   |     ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***                ****      ****                              |   |    |   |                           *** |   |              |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****    *****                               *****              *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  ||  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *************      
search RasMol script viewer Motif-ligand binding stats  betaturn .. ************       

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  || || |   || ||| |||        |  |               | | | **^*| ||  |  | || | |||||||   |||||||| || || | |  |  | | |||||||||||| ||| ||  ||| |||||  |    | | ||| |||||||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || || |   || ||| |||        |  |               | | ^** ||| ||  |  | || | |||||||   ^**||||| || || | |  |  | | |||||||||||| ||| ||  ||| |||||  |    | | ||| |||||||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  || || |   ^***|| |||        |  |               | | |   ||| ||  |  | ^*** |||||||   ^***|||| || || | |  |  | | |||||||||||| ||| ||  ||| |||||  |    | | ||| |||||||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  || || ^*****  || |||        |  |               | | |   ||| ||  |  |  | | |||||||   |||||||| || || | |  |  | | |||||||||||| ||| ||  ||| |||||  |    | | |^*****||||   |||||| |||^*****|| |    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  || || |       || |||        |  |               | | |   ||| ||  |  |  | | |||||||   |||||||| || ********************||||||| ||| ||  ||| |||||  |    | | ||| |||||||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  || || |       || |||        |  |               | | |   ||| ||  |  |  | | |||||||   |||||||| ||  | | |  |  | | |||||||||||| ||| ||  ||| |||||  |    ************|||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  || || |       || |||        |  |               | | |   *************** | |||||||   |||||||| ||  | | |  |  | | |||||||||||| ||| ||  ||| |||||  |      | ||| |||||||   |||||| ||||||||||| |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  || || |       |*****        |  |               | | |    || ||  |  |  | *******||   ***********  | | |  |  | *****|***********| |**********||  |      | ||| |*****|   *****************| |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  || || |       || ||         |  |               | ***    || ||  |  |  | | |||| ||   |||||||| ||  | | |  |  | | || ||||||||| ||| ||  | | || ||  |      | ||| |||||||   |||||| | ||||||||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****| || |       *****         ****               | |      *****  ****  | *********   ************** | |  **** *****************| |**** **********      ****| |*****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ******                                        | |                |  |      |  |                  | |         |   |    |   | | |   |                   | | |  || |   |||  |   |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |                |  |      |  |                  ***         |   |    |   *** |   |                   *** |  || |   ***  |   |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                ****      ****                              |   |    |   |   |   |                   *** |  ****    |   |   |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                 *****    *****   *****                       *****      *****   *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. **************     
search RasMol script viewer Motif-ligand binding stats  betaturn .. *************      

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||  | |   || ||   ||  || ||||| ||           | || | ||**^*|  || |  | || |  ||| ||   | |||||| || |  | | |||||||||||||  ||||| |||         |  ||| || | ||  ||| |||||||   | || ||| ||| |||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||  | |   || ||   ||  || ||||| ||           | || | ^**||||  || |  | || |  ||| ||   ^**||||| || |  | | |||||||||||||  ||||| |||         |  ||| || | ||  ||| |||||||   | || ||| ||| |||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ||  | |   ^***|   ||  || ||||| ||           | || | || ||||  || |  | ^***  ||| ||   ^***|||| || |  | | |||||||||||||  ||||| |||         |  ||| || | ||  ||| |||||||   | || ||| ||| |||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||  | ^*****  |   ||  || ||||| ||           | || | || ||||  || |  |  | |  ||| ||   | |||||| || |  | | |||||||||||||  ||||| |||         |  ||| || | ||  |^*****||||   | || ||| |^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|| ||  | |       |   ||  || ||||| ||           | || | || ||||  || |  |  | |  ||| ||   | |||||| || ********************  ||||| |||         |  ||| || | ||  | | |||||||   | || ||| ||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|| ||  | |       |   ||  || ||||| ||           | || | || ||||  || |  |  | |  ||| ||   | |||||| ||    | | |||||||||||||  ||||| |||         |  ||| || | ************|||   | || ||| ||| || ||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|| ||  | |       |   ||  || ||||| ||           | || | || |*************** |  ||| ||   | |||||| ||    | | |||||||||||||  ||||| |||         |  ||| || |  |  | | |||||||   | || ||| ||| || ||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|| ||  | |       |   |*********|| ||           | || | *****|***** |  |  | *****| ||   *****|*****    | | |****************|*****|         |  ||| || |  |  | | ||*****   | *****************|    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||  | |       |   ||  || || || ||           ***| | || ||||  |  |  |  | |  ||| ||   | |||||| |     | | ||||| |||||||  | ||| |||         |  ||| || |  |  | | |||||||   | || ||| ||| || || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|  | |       |   |**************              | | *************  |  | *********   **********     | | |**** ********** |*****|         ********* ****  | | |*****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |  ***       |   |                            | |  |   |         |  |      |  |                  | | ||||    |   |    |   | |                         | | |  || |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest .. |  |            |   |                            | |  |   |         |  |      |  |                  *** ****    |   |    |   ***                         *** |  || |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche .. ****            |   |                            ***  |   |         ****      ****                              |   |    |   |                               |  ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                 *****                                                     *****    *****                               *****              *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||| |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |***** *******     
search RasMol script viewer Motif-ligand binding stats  betaturn .. *************      

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  | ||   || |||| ||||| || ||  |  |   | |      | | | **^*||||| |  | || |   || ||   | ||| |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  | ||| ||| |||||||   | | || ||||| ||| ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | ||   || |||| ||||| || ||  |  |   | |      | | ^**|||||||| |  | || |   || ||   ^**|| |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  | ||| ||| |||||||   | | || ||||| ||| ||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  | ||   ^***||| ||||| || ||  |  |   | |      | | | ||||||||| |  | ^***   || ||   ^***| |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  | ||| ||| |||||||   | | || ||||| ||| ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |^*****  ||| ||||| || ||  |  |   | |      | | | ||||||||| |  |  |     || ||   |  || |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  | ||| |^*****||||   | | || |||^***** ||     
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |  | |        ||| ||||| || ||  |  |   | |      | | | ||||||||| |  |  |     || ||   |  || ||||||********************  |  || ||| ||| ||| ||||  ||  | ||| ||| |||||||   | | || ||||| ||  ||     
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |  | |        ||| ||||| || ||  |  |   | |      | | | ||||||||| |  |  |     || ||   |  || |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  | ************|||   | | || ||||| ||  ||     
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |  | |        ||| ||||| || ||  |  |   | |      | | | ||***************     || ||   |  || |||||||| ||| ||||| |||||||  |  || ||| ||| ||| ||||  ||  |  || ||| |||||||   | | || ||||| ||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  | |        |******** || ||  |  |   | |      | | *********** |  |  |     || ||   |  |*********| ||| ||||| ******|  |  || ||| ||**************  |  || ||| |*****|   | | |******* |*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  | |        |******** ***********   | |      | | *************  |  |     ****|   *****************| |**** **********  *****| |**************   ********| |*****|   | | **************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***        |   |                   ***      | |                |  |      |  |                  | | ||||    |   |        | | |   ||   |           |  | | |  || |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |                |  |      |  |                  *** ****    |   |        *** |   ||   |           |  *** |  || |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***                ****      ****                              |   |            |   ||   |           |  *** |  ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                           |   |            |   ||   |           ****** |   |              |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****            **********                  *****              *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. **************|    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ***************    

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |     |   || ||  ||||||| |  |  || ||        | || | ||**^*|||||||| |||| |   || ||   ||||| || || |||| |  |  | | |||||  | ||| |||   | ||||||||  ||    | | |||  |||||| | |||||||| ||| ||| || | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |     |   || ||  ||||||| |  |  || ||        | || | ^**||||||||||| |||| |   || ||   ^**|| || || |||| |  |  | | |||||  | ||| |||   | ||||||||  ||    | | |||  |||||| | |||||||| ||| ||| || | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |     |   ^***|  ||||||| |  |  || ||        | || | |||||||||||||| ||^***   || ||   ^***| || || |||| |  |  | | |||||  | ||| |||   | ||||||||  ||    | | |||  |||||| | |||||||| ||| ||| || | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |     ^*****  |  ||||||| |  |  || ||        | || | |||||||||||||| || |     || ||    | || || || |||| |  |  | | |||||  | ||| |||   | ||||||||  ||    | | |^*****|||| | |||||||| |^***** || | | 
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |             |  ||||||| |  |  || ||        | || | |||||||||||||| || |     || ||    | || || || ********************  | ||| |||   | ||||||||  ||    | | |||  |||||| | |||||||| ||| ||  || | | 
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |             |  ||||||| |  |  || ||        | || | |||||||||||||| || |     || ||    | || || ||  ||| |  |  | | |||||  | ||| |||   | ||||||||  ||    ************||| | |||||||| ||| ||  || | | 
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |             |  ||||||| |  |  || ||        | || | ||||***************     || ||    | || || ||  ||| |  |  | | |||||  | ||| |||   | ||||||||  ||      | |||  |||||| | |||||||| ||| ||  || | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |             ********** |  |  || ||        | || | ***********||| || |     *****    | || *********| |  |  | *****||  ***** |||   **************      | |||  |***** | ||********** |***** | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |             |  | || |  |  |  || ||        ***| ***||| ||||||||| || |     || ||    | || || ||  | | |  |  | | || ||  | ||| |||   | |||||| |  |       | |||  |||||| | |||||| | ||| ||  |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..****             ************  ********           | | ***************** |     ****|    ************* | |  **** ******|  ********|   *************       ****|  ****** ********************  | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                  | |  |   |         |  |      |  |                  | |         |   |    |   | |      |   |              | |    |  |   | |      |   |   |  *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |  |   |         |  |      |  |                  ***         |   |    |   ***      |   |              ***    |  |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***  |   |         ****      ****                              |   |    |   |        |   |              ***    ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****    *****        *****                                     *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || |**********     
search RasMol script viewer Motif-ligand binding stats  betaturn .. *************      

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  || |  |   || || |||||||     |  |  |   | |   | || | | **^*|  || ||||||| | || ||||   | ||| || || |||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | |||||||  ||||||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || |  |   || || |||||||     |  |  |   | |   | || | ^**||||  || ||||||| | || ||||   ^**|| || || |||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | |||||||  ||||||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  || |  |   ^***| |||||||     |  |  |   | |   | || | | |||||  || |||||^*** || ||||   ^***| || || |||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | |||||||  ||||||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  || |  ^*****  | |||||||     |  |  |   | |   | || | | |||||  || |||||||   || ||||       | || || |||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | |||||^*****||||   | |||||| |^*****|||||   
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  || |          | |||||||     |  |  |   | |   | || | | |||||  || |||||||   || ||||       | || || ********************||||||| ||| ||| ||| |||||  |  | |||||||  ||||||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  || |          | |||||||     |  |  |   | |   | || | | |||||  || |||||||   || ||||       | || ||  ||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | ************|||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  || |          | |||||||     |  |  |   | |   | || | | ||***************   || ||||       | || ||  ||| |  |  |||||||||||||||| ||| ||| ||| |||||  |  | |||||||  ||||||   | |||||| ||||||||||||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  || |          *********     |  |  |   | |   | || | *********** *****||   ******|       | *********| |  |  |**************| ||| ||*********||  |  | *****||  *****|   | *******************   
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  || |          | |||| |      |  |  |   | |   ***| | | || ||  |  |||| ||   || || |       | || ||  | | |  |  |||||||||||||||| ||| ||| ||| || ||  |  | |||||||  ||||||   | |||| | ||||||||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****| |          ********      *******   | |      | | **********  ******|   ***** |       ********** | |  **********************| |***************  ********|  *****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***                                  ***      | |              | | ||      |  |                  | |         |   |        | | |   ||   |           |  | |    |  |   | |      |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |              | | ||      |  |                  ***         |   |        *** |   ||   |           |  ***    |  |   ***      |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***              | ****      ****                              |   |            |   ||   |           |  ***    ****            |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                   |   |                                         |   |            |   ||   |           ******                    |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                   *****                                         *****            **********                                     *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || || ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *************      
search RasMol script viewer Motif-ligand binding stats  betaturn .. ************       

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  ||||   || |||  ||  ||    || ||           | || | ||**^*|| |||||||||| |||||||||   | ||| |||||||| | | ||  ||| |||||||||| | |||   || ||||||||  |  | ||| |||  ||||||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  ||||   || |||  ||  ||    || ||           | || | ^**||||| |||||||||| |||||||||   ^**|| |||||||| | | ||  ||| |||||||||| | |||   || ||||||||  |  | ||| |||  ||||||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  ||||   ^***||  ||  ||    || ||           | || | |||||||| ||||||||^***||||||||   ^***| |||||||| | | ||  ||| |||||||||| | |||   || ||||||||  |  | ||| |||  ||||||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  |||^*****  ||  ||  ||    || ||           | || | |||||||| |||||||| |  ||||||||      || |||||||| | | ||  ||| |||||||||| | |||   || ||||||||  |  | ||| |^*****||||   ||||||||||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |  ||||       ||  ||  ||    || ||           | || | |||||||| |||||||| |  ||||||||      || ||||||********************||||| | |||   || ||||||||  |  | ||| | |  ||||||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |  ||||       ||  ||  ||    || ||           | || | |||||||| |||||||| |  ||||||||      || |||||| | | | ||  ||| |||||||||| | |||   || ||||||||  |  | ************|||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |  ||||       ||  ||  ||    || ||           | || | ||||***************  ||||||||      || |||||| | | | ||  ||| |||||||||| | |||   || ||||||||  |  |  || | |  ||||||   ||||||||||||||||||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  ||||       |*********    || ||           | || | ******** *****||| |  *******|      |******** | | | ||  |**********||| | |||   *********||  |  ***** | |  ||||||   *******************|    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  ||||       ||  ||  |     || ||           ***| ***||| ||  |||||||| |  |||||| |      || || ||  | | | ||  ||| |||||| ||| | |||   || || || ||  |  |  |  | |  ||||||   |||||| | ||||||||| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  ||||       |********     *****              | | ***************** |  ****** |      *********** | | |**********************|   **************  ****  | |  *****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ****       |   |                            | |  |   |         |  |      |  |                  | ***       |   |    |   | |                         | |    |  |   |||  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |  |   |         |  |      |  |                  ***         |   |    |   ***                         ***    |  |   ***  |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***  |   |         ****      ****                              |   |    |   |                           ***    ****    |   |   |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                 *****                                                     *****    *****                                          *****   *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  ||  |********^| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. **************|||| 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****************** 

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |  ||| |  |  || |  |  |  ||  |        | || | | **^*|||||||| | || |    |  |   |||||||||||||| | |       |||||||| ||||  | | ||  | | ||||      | ||| |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  ||| |  |  || |  |  |  ||  |        | || | ^**|| |||||||| | || |    |  |   ^**||||||||||| | |       |||||||| ||||  | | ||  | | ||||      | ||| |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  |^***  |  || |  |  |  ||  |        | || | |  || |||||||| | ^***    |  |   ^***|||||||||| | |       |||||||| ||||  | | ||  | | ||||      | ||| |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ^*****    |  || |  |  |  ||  |        | || | |  || |||||||| | ||      |  |   |||||||||||||| | |       |||||||| ||||  | | ||  | | ||||      | ||| |^*****||||   | |||| |||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | |  | |    |  || |  |  |  ||  |        | || | |  || |||||||| | ||      |  |   ||||||||||||********************| ||||  | | ||  | | ||||      | ||| |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | |  | |    |  || |  |  |  ||  |        | || | |  || |||||||| | ||      |  |   |||||||||||| | | |       |||||||| ||||  | | ||  | | ||||      | ************|||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..       | |  | |    |  || |  |  |  ||  |        | || | |  |***************      |  |   |||||||||||| | | |       |||||||| ||||  | | ||  | | ||||      |  || |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  | |    ***** |  |  *****  |        | || | ***** *******| | ||      |  |   ||||*******| | | |       ************|  | | ||  | *****|      |  || |||  |*****   | |||***************    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  | |    |  |  |  |  |  ||  |        ***| ***  |  |||||| | | ||      |  |   |||||||||||| | | |       |||||||| || |  | | ||  | | || |      |  || |||  ||||||   | |||| |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | |    ****  **************           | | ************ | | ||      |  |   ************** | |       *********** **** | |**** ******      ********|  *****|   ********************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***  ***                                   | |              | | ||      |  |                  | |         |   |        | | |   |                   | |    |  |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |              | | ||      |  |                  ***         |   |        *** |   |                   ***    |  |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***              | ****      ****                              |   |            |   |                          ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                   *****                                         *****            *****                                          *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |  |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  **********| |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****************  

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  || ||||   || ||| |||  |     |  || |            | | ||**^*|  ||||||| || |  |||  |   | ||| |||||||||| |       | |||||| ||||| | | ||| ||| ||||| ||    ||| |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  || ||||   || ||| |||  |     |  || |            | | ^**||||  ||||||| || |  |||  |   ^**|| |||||||||| |       | |||||| ||||| | | ||| ||| ||||| ||    ||| |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  || ||||   ^***|| |||  |     |  || |            | | |||||||  ||||||| ^***  |||  |   ^***| |||||||||| |       | |||||| ||||| | | ||| ||| ||||| ||    ||| |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  || |||^*****  || |||  |     |  || |            | | |||||||  |||||||  | |  |||  |       | |||||||||| |       | |||||| ||||| | | ||| ||| ||||| ||    ||| |^*****||||   |||||| |||^*****||||||||
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  || ||||       || |||  |     |  || |            | | |||||||  |||||||  | |  |||  |       | ||||||********************| ||||| | | ||| ||| ||||| ||    ||| |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  || ||||       || |||  |     |  || |            | | |||||||  |||||||  | |  |||  |       | |||||| ||| |       | |||||| ||||| | | ||| ||| ||||| ||    ************|||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  || ||||       || |||  |     |  || |            | | ||||*************** |  |||  |       | |||||| ||| |       | |||||| ||||| | | ||| ||| ||||| ||     || |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..***** ||||       || |||  |     ***** |            | | ****************  | *****|  |       ***********| |       *****|******** | | |***************     || |||*****|||   |********************|||
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  ||||       || |||  |     |  |  |            | ***||||||  | || ||  | |  | |  |       | || ||  | | |       | || ||| || |  | | ||| ||| || || ||     || |||| ||||||   |||||| |||||||||||||||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  ||||       *********     *******            | | ****************  | **** |  |       ********** | |       **************** | |***************     |****|*******|   *********************|||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ****       |   |                            | |                |  |      |  |                  | |         |   |        | | |   |                |  | |    |  |   | |      |   |      ****
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                            | |                |  |      |  |                  ***         |   |        *** |   |                |  ***    |  |   ***      |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***                ****      ****                              |   |            |   |                |    |    ****            |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                           |   |            |   |                ******                    |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****            *****                                          *****          

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |||||| |********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. **************     
search RasMol script viewer Motif-ligand binding stats  betaturn .. *************      

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |     |   || |          |  ||  ||     | |      | | ||**^*||||| | || || |    |  |   | |||||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      ||||| ||| |||||||   | |||| ||||| |||||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |     |   || |          |  ||  ||     | |      | | ^**|||||||| | || || |    |  |   ^**||||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      ||||| ||| |||||||   | |||| ||||| |||||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |     |   ^***          |  ||  ||     | |      | | ||||||||||| | || ^***    |  |   ^***|||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      ||||| ||| |||||||   | |||| ||||| |||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |     ^*****            |  ||  ||     | |      | | ||||||||||| | || ||      |  |     | |||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      ||||| |^*****||||   | |||| |||^*****||      
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  |                       |  ||  ||     | |      | | ||||||||||| | || ||      |  |     | ||||||||********************| ||||  | | ||| ||||||||      ||||| ||| |||||||   | |||| ||||| || ||      
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  |                       |  ||  ||     | |      | | ||||||||||| | || ||      |  |     | |||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      ||************|||   | |||| ||||| || ||      
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  |                       |  ||  ||     | |      | | ||||***************      |  |     | |||||||||||||| ||||| |||||||| ||||  | | ||| ||||||||      || || ||| ||| |||   | |||| ||||| || ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |                       |  |*****     | |      | | *********** | || ||      |  |     *************||| ||||| ************|  | | ||*********|      ***** ||| |******   | |||********** ||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |                       |  ||  |      | |      | | ||||||| ||  | || ||      |  |     | |||||||| | ||| ***|| |||||||| ||||  | | ||| ||||||||      || || ||| ||| ||    | |||| || |  || ||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..****                       ********      | |      | | ******************|      |  |     ***************| |**** ***********|**** | |***********      ********| |*****    ******************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                         ***      | |  |   |         |  |      |  |                  | | ||||    |   |    |   | | |   |                |  | | |   |     | |          |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |  |   |         |  |      |  |                  *** ****    |   |    |   *** |   |                |  *** |   |     ***          |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***  |   |         ****      ****                              |   |    |   |   |   |                |  *** |   |                  |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                       |   |                                                     |   |    |   |   |   |                ****** |   |                  |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                     *****    *****   *****                       *****                  *****      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || || ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || |*********      
search RasMol script viewer Motif-ligand binding stats  betaturn .. *************      

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAX
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF8PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ07812
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  ||    |   || ||   |  || | ||||||      | || |   | | | **^*|| || |  | |||| |  |  || || ||| || |||||||||  |  |   | |||||||||| |||      || |||||  |  ||||| ||| |||||||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  ||    |   || ||   |  || | ||||||      | || |   | | ^**||||| || |  | |||| |  |  || |^**|| || |||||||||  |  |   | |||||||||| |||      || |||||  |  ||||| ||| |||||||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ||    |   ^***|   |  || | ||||||      | || |   | | | |||||| || |  | ^*** |  |  || |^***| || |||||||||  |  |   | |||||||||| |||      || |||||  |  ||||| ||| |||||||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  ||    ^*****  |   |  || | ||||||      | || |   | | | |||||| || |  |  ||  |  |  || |   || || |||||||||  |  |   | |||||||||| |||      || |||||  |  ||||| |^*****||||   | |  | |||^*****||||    
search RasMol script viewer Motif-ligand binding stats  BH1 ..|  ||            |   |  || | ||||||      | || |   | | | |||||| || |  |  ||  |  |  || |   || || |||********************||||||| |||      || |||||  |  ||||| ||| |||||||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..|  ||            |   |  || | ||||||      | || |   | | | |||||| || |  |  ||  |  |  || |   || || ||| |||||  |  |   | |||||||||| |||      || |||||  |  ||************|||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  BH3 ..|  ||            |   |  || | ||||||      | || |   | | | ||***************|  |  |  || |   || || ||| |||||  |  |   | |||||||||| |||      || |||||  |  || || ||| |||||||   | |  | |||||||||||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****            |   ***** | *****|      | || |   | | *********** |  |  ||  |  |  || |   || *********|||  |  |   | ********|| |||      |*****||  |  ***** ||| *******   | |  ********|******    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****             |   ****  ********      | || |   | | ****************  |****  |  || |   **************|  ****   ********* *****|      |**********  ********| ******|   | |  ***************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   |                   ***| |   | |                |  |      |  |***               | |         |   |        | |      |   |           |  | |    |  |   | |      |   |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |                      ***   | |                |  |      |  |                  ***         |   |        ***      |   |           |  ***    |  |   ***      |   |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                            ***                ****      ****                              |   |                 |   |           |  ***    ****            |   |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                           |   |                 |   |           ******                    |   |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                           *****                 *****                                     *********      

chain B : BCL-2-LIKE PROTEIN 11
member of: PANTHER:searchPTHR12044PFAM:searchPF08945PIRSF:searchPIRSF037827UniProt:searchO43521
sec str:  ...hhhhhhhhhhhhhhhhhhh
sequence :  ..EIWIAQELRRIGDEFNAYYA
seq num:  ..145       155       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  ||********^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  |*******|    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ***************    

   New search    2k7w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML