triangle PDBeMotif: 2k2v  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification calcium-binding protein    | release date: Sun, Apr 13, 2008
Title anabaena ccbp in the calcium-bound form
Authors C.JIN, X.ZHANG, Y.HU
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV
EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        ||||||||  |  |  || ||||  || ||||        **^***^*  |          |  || |           | |   | ||||||      |  || || ||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        ||||||||  |  |  || ||||  || ||||           ^** |  |          |  || |           | |   ^**|||||      |  || || ||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ||||||||  |  |  || ||||  || ||||               ^***          |  || |           | |     ||^***      |  || || ||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *******|  |  |  |*****|  |*****|                             ***** |           | |     || ||       ***** |*******|||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****** |  ****  ************** |                             *******           | |     ****|       ****************|  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   |  |  |              |  |                                               ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****                                                        ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | | | | ||||||  |  |     |  | || || ||        **^***^*  |                        | |       | ||||||    || |||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ||||||  |  |     |  | || || ||           ^** |  |                        | |       ^**|||||    || |||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | | ||||||  |  |     |  | || || ||               ^***                        | |         ||^***    || |||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | | *******|  |  |     |  | || *****                                           | |         || ||     |***************| |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | | | |||| |  |  |     |  | || || ||                                           | |         || ||     ***** | | || || | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | *** |||| |  |  |     |  | || || ||                                           ***         || ||      | || | | || || | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |   ********  ****     ************|                                                       ****|      ****** ******* | |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |             |  |              |  |                                                        |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***             ****              ****                                                        ****                     ***  

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | | | | |  ||   |  |     |  | | ||||||        **^***^*  |                        | | |  |  | ||||||    ||||||| |  |||  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | |  ||   |  |     |  | | ||||||         | ^** |  |                        | | |  |  ^**|||||    ||||||| |  |||  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | | |  ||   |  |     |  | | ||||||         |  |  ^***                        | | |  |    ||^***    ||||||| |  |||  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | | | *****   |  |     |  | *******|         |  |  |                           | | |  |    *****     ******* *****|  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | | | |  |    |  |     |  | | |||| |         |  |  |                           | | |  |    || ||     *****|  |  | |  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | *** |  |    |  |     |  | | |||| |         |  |  |                           *** |  |    || ||     ||||||  |  | |  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |     ****    ****     **** ****** |         |  ****                               ****    *****     ******  **** **** |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |             |  |              |  |         |  |                                  |  |     |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***             ****              ****         ****                                  ****     ****                          

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |        || || |  |     |  | | ||||||        **^***^*  |          || ||             | |   | ||||||    | ||||||||||||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |        || || |  |     |  | | ||||||           ^**||  |          || ||             | |   ^**|||||    | ||||||||||||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |        || || |  |     |  | | ||||||           |  |^***          || ||             | |     ||^***    | ||||||||||||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |        || || |  |     |  | | ******           |  |              *****             | |     *****     ****************| |  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |        || || |  |     |  | | ||||||           |  |              || ||             | |     || ||     *****|||||||||| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |        ***** ****     **** *******|           |  |              *****             | |     ****|     ***************** |  
search RasMol script viewer Motif-ligand binding stats  nest .. ***              |  |              |  |           |  |                                ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****              ****           ****                                         ****                          

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. ||||     |||| |  |  |     |  | |  ||  |        **^***^*| |             || ||      | | |  |  | ||||||    |||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||||     |||| |  |  |     |  | |  ||  |           ^**||| |             || ||      | | |  |  ^**|||||    |||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||||     |||| |  |  |     |  | |  ||  |           | ||^***             || ||      | | |  |    ||^***    |||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||||     |||| |  |  |     |  | |  ||  |           | ||||               || ||      | | |  |    *****     ****************| |  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ||||     |||| |  |  |     |  | |  ||  |           | ||||               || ||      | | |  |    || ||     *****|| || |||| | |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. ||||     |||| |  |  |     |  | |  ||  |           | ||||               || ||      *** |  |    || ||     ***|||| || |||| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||||     ******  ****     **** ****|  |           ****||               ****|          ****    *****     ***************** |  
search RasMol script viewer Motif-ligand binding stats  nest .. ****      |   |  |  |              |  |             ****                |  |          |  |     |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***      |   |  ****              ****                                 ****          ****     ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | | || | || | |  |  |  || |||| | ||||||        **^***^*  |             |  ||      | | |  |  | |||||||  || ||||| || |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | | || | || | |  |  |  || |||| | ||||||           ^** |  |             |  ||      | | |  |  ^**||||||  || ||||| || |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | || | || | |  |  |  || |||| | ||||||               ^***             |  ||      | | |  |    ||^***|  || ||||| || |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | || | || | |  |  |  |*****| | |*****                                *****      | | |  |    || || |  |******* |*******| |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. | | || | || | |  |  |  || || | | ||||||                                |  |       *** |  |    || || |  || || |  || |||| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ****** **** |  ****  ******* *******|                                ****           ****    ****| |  |***************** |  
search RasMol script viewer Motif-ligand binding stats  nest .. | |       |   |  |  |              |  |                                               |  |     |  | |  |                ***  
search RasMol script viewer Motif-ligand binding stats  niche .. ***       |   |  ****              ****                                               ****     **** ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. ||||  | |||||||  |  |  | ||||| | ||||||        **^***^*| |             |  |       | |       | ||||||     |||||||| | ||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||||  | |||||||  |  |  | ||||| | ||||||           ^**||| |             |  |       | |       ^**|||||     |||||||| | ||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||||  | |||||||  |  |  | ||||| | ||||||              |^***             |  |       | |         ||^***     |||||||| | ||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||||  | |*****|  |  |  ******* | ******              | |               |  |       | |         || ||      *******| *****|| |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. ||||  | ||||| |  |  |  | || || | ||||||              | |               |  |       ***         || ||      |||||| | | || || |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||||  | |******  ****  ******* *******|              | |               ****                   ****|      ******** ******* |  
search RasMol script viewer Motif-ligand binding stats  nest .. ****  *** |   |  |  |              |  |              | |                                       |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****              ***                                       ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |||| | |||||||   |  |     |  | |  || ||        **^***^*| |             |  ||      |  |      | ||||||      || |||||| ||| |||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||| | |||||||   |  |     |  | |  || ||           ^**||| |             |  ||      |  |      ^**|||||      || |||||| ||| |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |||| | |||||||   |  |     |  | |  || ||              |^***             |  ||      |  |        ||^***      || |||||| ||| |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |||| | *******   |  |     |  | |  *****              | |               *****      |  |        || ||       |***********| |||  
search RasMol script viewer Motif-ligand binding stats  asxturn .. |||| ***|||||    |  |     |  | |  || ||              | |               |  |       |  |        || ||       || || ||  ||| |||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||||   ******    ****     **** *******|              | |               ****       ****        *****       ****************|  
search RasMol script viewer Motif-ligand binding stats  nest .. ****             |  |              |  |              | |                                       |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***             ****              ****              ***                                       ****                          

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       ||||||| |  |  |     | || ||||||||        **^***^*| |          || ||||           | |   | ||||||    ||| |||  | ||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ||||||| |  |  |     | || ||||||||           ^**||| |          || ||||           | |   ^**|||||    ||| |||  | ||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ||||||| |  |  |     | || ||||||||              |^***          || ||||           | |     ||^***    ||| |||  | ||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |*****| |  |  |     | ***********              | |            ******|           | |     || ||     |******  *******|||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ||||||| |  |  |     | || | ||||||              | |            || || |           | |     || ||     *** ||   | |||| |||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |********  ****     ************|              | |            *******           | |     *****      *****   *********|  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | | |   |  |  |              |  |              ***                              | |      |  |                     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..       *** |   |  |  |              |  |                                               ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****                                                        ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | || | ||||||  |  |  ||||||| | ||| ||        **^***^*| |             |  |       |  ||  |  | ||||||    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | || | ||||||  |  |  ||||||| | ||| ||           ^**||| |             |  |       |  ||  |  ^**|||||    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | || | ||||||  |  |  ||||||| | ||| ||           | ||^***             |  |       |  ||  |    ||^***    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | || *******|  |  |  |*****| | |*****           | || |               |  |       |  ||  |    || ||     ********|*******| |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | || | |||| |  |  |  ||||||| | ||| ||           | || |               |  |       |  ||  |    || ||     *****|| || |||| | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |*** |||| |  |  |  ||||||| | ||| ||           | || |               |  |       |  ||  |    || ||     ***| || || |||| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |  ********  ****  ******* *******|           | || |               ****       ********    ****|     ***************** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***            |  |            | | ||           | || |                              |  |     |  |                     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  |            | | ||           | || |                              |  |     |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****            | ****           | |***                              ****     ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  *****            | |                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                   ***                                                                        

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |  |||  |  |  |  | ||||||  | ||||        **^***^*| |             |  |       | | | |   | ||||||     ||||||||| ||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |||  |  |  |  | ||||||  | ||||           ^**||| |             |  |       | | | |   ^**|||||     ||||||||| ||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  |||  |  |  |  | ||||||  | ||||              |^***             |  |       | | | |     ||^***     ||||||||| ||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |  |||  |  |  |  ********  *****|              | |               |  |       | | | |     *****      *******|*******|||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  |||  |  |  |  | || ||   | || |              | |               |  |       *** | |     || ||      |||||| || |||| |||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|****  ****  *******   **** |              | |               ****           | |     ****|      *****************|  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   |  |  |              |  |              | |                              ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****              ***                                       ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | || ||||||||  |  |  || |||| | ||||||        **^***^*| |             |  |       | |||| |  | |||||||  |   | ||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | || ||||||||  |  |  || |||| | ||||||           ^**||| |             |  |       | |||| |  ^**||||||  |   | ||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | || ||||||||  |  |  || |||| | ||||||            | |^***             |  |       | |||| |    ||^***|  |   | ||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |*********|  |  |  |*****| ********            | |||               |  |       | |||| |    || || |  |   *****|*******| |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |||| | |  |  |  || |||| | ||||||            | |||               |  |       ***||| |    || || |  |   | || || |||| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |******** |  ****  ***************|            ****|               ****         |||| |    ***** |  |   ************** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***     |   |  |  |              |  |              | |                            |||| |     |  | |  |                | |  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   |  |  |              |  |              ***                            **** |     |  | |  |                ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****                                                ***     **** ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | |   | ||||||  |  |  |  || | || || ||        **^***^*  |             || ||                | ||||||    ||| ||| ||  ||  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |   | ||||||  |  |  |  || | || || ||           ^** |  |             || ||                ^**|||||    ||| ||| ||  ||  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |   | ||||||  |  |  |  || | || || ||               ^***             || ||                  ||^***    ||| ||| ||  ||  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |   *******|  |  |  ***** | || *****                                || ||                  || ||     |****** |*****  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |   | |||| |  |  |  |  |  | || || ||                                || ||                  || ||     *** ||  ||  ||  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |   ********  ****  ***************|                                ****|                  *****      **************** |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |      |   |  |  |              |  |                                 |  |                   |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***      |   |  ****              ****                                 ****                   ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        | |||| |  |  |  || |||| |  || ||        **^***^*| |           | ||||           | |   | ||||||     ||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |||| |  |  |  || |||| |  || ||           ^**||| |           | ||||           | |   ^**|||||     ||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |||| |  |  |  || |||| |  || ||           | ||^***           | ||||           | |     ||^***     ||||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****| |  |  |  |*****| |  *****           | ||||             *****|           | |     || ||      *******|*******| |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ********  ****  ***************|           ****||             ******           | |     ****|      **************** |  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   |  |  |              |  |             ****                              ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****                                                        ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||   | |||||   |  |  ||||||  |  || ||        **^***^*  |           |  |  |          | |   | ||||||    |||||||| | ||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||   | |||||   |  |  ||||||  |  || ||           ^** |  |           |  |  |          | |   ^**|||||    |||||||| | ||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||   | |||||   |  |  ||||||  |  || ||               ^***           |  |  |          | |     ||^***    |||||||| | ||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | ||   *******   |  |  |*****  ********                              |  |  |          | |     || ||     |******* *******|||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | ||   | || |    |  |  ||||||  |  || ||                              |  |  |          | |     || ||     *****||  | |||| |||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ||   ******    ****  ******  *******|                              ****  |          | |     *****      ******  *********|  
search RasMol script viewer Motif-ligand binding stats  nest .. ***|             |  |              |  |                                 |  |          ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche .. ****             ****              ****                                 ****                   ****                          

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  | ||||||||  |  |     |  | |  || ||        **^***^*  |                        | |||| |  | ||||||    | |||||| |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  | ||||||||  |  |     |  | |  || ||           ^** |  |                        | |||| |  ^**|||||    | |||||| |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |  | ||||||||  |  |     |  | |  || ||               ^***                        | |||| |    ||^***    | |||||| |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |  | |******|  |  |     |  | ********                                           | |||| |    *****     | ****** |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |  | |||||| |  |  |     |  | |  || ||                                           *****| |    || ||     *****||  |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |  ***||||| |  |  |     |  | |  || ||                                           ***| | |    || ||       || ||  |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     *******  ****     **** *******|                                           **** | |    ****|       *****  ******** |  
search RasMol script viewer Motif-ligand binding stats  nest .. | |       |   |  |  |              |  |                                                ***     |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche .. ***       |   |  ****              ****                                                        ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     | || ||||||  |  |    || || | ||||||        **^***^*| |           | || |           | |   | ||||||    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | || ||||||  |  |    || || | ||||||           ^**||| |           | || |           | |   ^**|||||    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | || ||||||  |  |    || || | ||||||            | |^***           | || |           | |     ||^***    | |||||||| |||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |*******|  |  |    || || ********            | |||             | || |           | |     *****     ********|| |***** |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | || |||| |  |  |    || || | ||||||            | |||             | || |           | |     || ||     *****|| || |||||| |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |********  ****    ***** *******|            ****|             ******           | |     ****|     ***************** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     ***          |  |              |  |              | |                              | |      |  |                     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  |              |  |              ***                              ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****              ****                                                        ****                          

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | | | | ||||||| |  |  ||||||| | ||||||        **^***^*| |          |  ||  |      | |||     | ||||||    | || ||||  |||| | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ||||||| |  |  ||||||| | ||||||           ^** || |          |  ||  |      | |||     ^**|||||    | || ||||  |||| | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | | ||||||| |  |  ||||||| | ||||||             | ^***          |  ||  |      | |||       ||^***    | || ||||  |||| | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | | *******|| |  |  |*****| *******|             |  |            *****  |      | |||       || ||     | ***********|| | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | | | |||| || |  |  ||||||| | |||| |             |  |            |  ||  |      *****       || ||     | || || |  | || | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | *** |||| || |  |  ||||||| | |||| |             |  |            |  ||  |      ***|        || ||     ***| || |  | || | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |   ********* ****  ******* ****** |             ****            ****|  |      ****        *****       *************** |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |             |  |              |  |                                 |  |                   |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***             ****              ****                                 ****                   ****                          

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| | | |  |||||||  |  |     |  |||  || ||        **^***^*| |             |  |       | | | ||  | ||||||    | ||||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | | |  |||||||  |  |     |  |||  || ||          |^**||| |             |  |       | | | ||  ^**|||||    | ||||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | | |  |||||||  |  |     |  |||  || ||          | | |^***             |  |       | | | ||    ||^***    | ||||||| ||||||| |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| | | |  |*****|  |  |     *****|  *****          | | |||               |  |       | | | ||    || ||     ****************| |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| | | |  ||||| |  |  |     |  | |  || ||          | | |||               |  |       | | | ||    || ||     *****| || || || | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..| | | |  ||||| |  |  |     |  | |  || ||          | | |||               |  |       *** | ||    || ||     ***| | || || || | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..| | | **********  ****     **** *******|          | ****|               ****           ****    ****|     ***************** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |      |   |  |  |              |  |          *** | |                              | |      |  |                     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |      |   |  |  |              |  |              ***                              ***      |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***      |   |  ****              ****                                                        ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALR1010 PROTEIN
member of: PFAM:searchPF11535UniProt:searchQ8YY42
JMol viewer RasMol script viewer  CA 128A  ..                    * **  *                                                                                                   
JMol viewer RasMol script viewer  CA 127A  ..                    | ||  |         ** **                                                                                     
sec str:  .........hhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeeeeeee......eeeeeeeeeee.hhhhhh...eeeeee........eeee...eeee..hhhhhhhhhhhhhhhhhh...
sequence :  ..MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  |  ||| |||  |  |     |  |  || ||||        **^***^*| |          || ||         | | |  |  | ||||||    ||| |||||||||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |  ||| |||  |  |     |  |  || ||||           ^**||| |          || ||         | | |  |  ^**|||||    ||| |||||||||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |  ||| |||  |  |     |  |  || ||||              |^***          || ||         | | |  |    ||^***    ||| |||||||||||||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  *********|  |  |     |  |  ******|              | |            *****         | | |  |    *****     |***************|||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |  ||| | |  |  |     |  |  || || |              | |            || ||         | | |  |    || ||     *****|||||||||| |||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |  ||| | |  |  |     |  |  || || |              | |            || ||         *** |  |    || ||      || ||||||||||| |||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *********** |  ****     *********** |              | |            *****             ****    ****|      *****************|  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   |  |  |              |  |              | |                              |  |     |  |                     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |  ****              ****              ***                              ****     ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                              

   New search    2k2v:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML