triangle PDBeMotif: 2jqa  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification metal binding protein    | release date: Wed, May 30, 2007
Title solution structure of apo-dr1885 from deinococcus radioduran
Authors E.KATSARI, I.BERTINI, K.KUB, L.BANCI, N.KATSAROS, S.CIOFI BAFFONI
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHS
GGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  | |                 |  |     |    | | ||||      ||^***         | ||        | || |  |                |  ||           |  |  ^***|           | | | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  | |                 |  |     |    | | ^**|      |^**           | ||        | || |  |                |  ||           |  |    ^**           ^** | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  | |                 |  |     |    | | ^***      | |            | ||        | || |  |                |  ||           |  |                      | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  | |                 |  |     ^***** |  |        | |            | ||        | |^*****                |  ||           |  |                      | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |                 |  |            |  |        | |            | ||        | || |                   *****           |  |                      | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |                 |  |            |  |        | |            | ||        | || |                   ****            |  |                      | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***                 |  |            |  |        ***            | ||        | || |                                   |  |                      ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                      |  |            |  |                       | ||        | |***                                   |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                      ****            ****                       ****        | |                                      ****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***         ***                                                                     

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                      | || |   |    | | ||||       |^***         |  |           |    |  |     | |                           ^***|           | |   | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                      | || |   |    | | ^**|       ^**           |  |           |    |  |     | |                             ^**           ^**   | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      | || |   |    | | ^***                     |  |           |    |  |     | |                                                 | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      | || |   ^***** |  |                       |  |           ^*****  |     | |                                                 | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      | || |          |  |                       |  |                ****     | |                                                 | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                      ******          |  |                       |  |                |  |     | |                                                 | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |  |                       |  |                |  |     | |                                                 ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                ****     ***                                                    

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..          | |            | |   |    | | ||||       |^***|        |  |           |    |                        |  |    || |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..          | |            | |   |    | | ^**|       ^**| |        |  |           |    |                        |  |    || |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..          | |            | |   |    | | ^***          | |        |  |           |    |                        |  |    || |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..          | |            | |   ^***** |  |            | |        |  |           ^*****                        |  |    || |                           
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |            | |          ****            | |        |  |                                         |  |    ****                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          ***            ***          |  |            | |        |  |                                         |  |     | |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****            ***        ****                                         ****     ***                           

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                              ||| | | | ||||       |^***         |  |           |    | |      |  |    |  |    |  |     | |  ^***|  | |      | |  ||||
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                              ||| | | | ^**|       ^**           |  |           |    | |      |  |    |  |    |  |     | |    ^**  | |      ^**  ||||
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                              ||| | | | ^***                     |  |           |    | |      |  |    |  |    |  |     | |         | |           ||||
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                              |^***** |  |                       |  |           ^***** |      |  |    |  |    |  |     | |         | |           ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              | | | | |  |                       |  |                | |      ****    ****    |  |     | |         | |           ||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              | | *** |  |                       |  |                ***                      |  |     | |         | |           ||||
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***     |  |                       |  |                                         |  |     | |         ***           ****
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                                         ****     ***                           

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                              |||   | | ||||       |^***         |  |          |||   |                |  ||   |  |    || |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                              |||   | | ^**|       ^**           |  |          |||   |                |  ||   |  |    || |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                              |||   | | ^***                     |  |          |||   |                |  ||   |  |    || |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                              |^***** |  |                       |  |          |^*****                |  ||   |  |    || |                           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                              | |     |  |                       |  |          | |                    *****   |  |    || |                           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              | |     ****                       |  |          | |                    ****    ****    ****                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              ***     |  |                       |  |          ***                                     | |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                                                  ***                           

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                         | |   |    | | ||||       |^***|   | |  |  |           |    |        | |     |  ||           || |  ^***|    | |    | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                         | |   |    | | ^**|       ^**| |   | |  |  |           |    |        | |     |  ||           || |    ^**    | |    ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                         | |   |    | | ^***          | |   | |  |  |           |    |        | |     |  ||           || |           | |             
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                         | |   ^***** |  |            | |   | |  |  |           ^*****        | |     |  ||           || |           | |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         | |          |  |            | |   | |  |  |                         | |     *****           || |           | |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | |          |  |            | |   | |  |  |                         | |     ****            ****           | |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         ***          |  |            ***   ***  |  |                         ***                      | |           | |             
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |  |                       |  |                                                  | |           ***             
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                                                  ***                           

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                         | |  |||   | | ||||       |^***| |      |  |           | |  |        |  |                    |  |  ^***|  ||||     | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                         | |  |||   | | ^**|       ^**  | |      |  |           | |  |        |  |                    |  |    ^**  ||||     ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                         | |  |||   | | ^***            | |      |  |           | |  |        |  |                    |  |         ||||              
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                         | |  |^***** |  |              | |      |  |           ^*****        |  |                    |  |         ||||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | |  | |     ****              | |      |  |           | |           ****                    ****         ||||              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         ***  ***     |  |              ***      |  |           | |                                   |  |         ||||              
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***     |  |                       |  |           | |                                   |  |         ****              
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****           ***                                   ****                           

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                               |  | | | ||||       |^***|        |  |           |   || |          | | |  ||           |  |  ^***|           | |  ||||
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                               |  | | | ^**|       ^**| |        |  |           |   || |          | | |  ||           |  |    ^**           ^**  ||||
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                               |  | | | ^***          | |        |  |           |   || |          | | |  ||           |  |                       ||||
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                               ^***** |  |            | |        |  |           ^***** |          | | |  ||           |  |                       ||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                  | | |  |            | |        |  |               |  |          | | *****           |  |                       ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                  | | ****            | |        |  |               |  |          | | ****            ****                       ||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                  *** |  |            ***        |  |               |  |          ***                 |  |                       ||||
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |  |                       |  |               |  |                              |  |                       ****
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****               ****                              ****                           

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                       | |    |||   | | ||||       |^***         |  |           |    |        | |     |  |       | |  |  |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                       | |    |||   | | ^**|       ^**           |  |           |    |        | |     |  |       | |  |  |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                       | |    |||   | | ^***                     |  |           |    |        | |     |  |       | |  |  |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                       | |    |^***** |  |                       |  |           ^*****        | |     |  |       | |  |  |                           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |    | |     |  |                       |  |                         | |     ****       | |  ****                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       | |    | |     |  |                       |  |                         ***                ***  |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..                       | |    ***     |  |                       |  |                                                 |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                       ***            ****                       ****                                                 ****                           

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                         | |   |  | | | ||||       |^***         |  |           |    |          | |                         ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                         | |   |  | | | ^**|       ^**           |  |           |    |          | |                           ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                         | |   |  | | | ^***                     |  |           |    |          | |                                                  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                         | |   ^***** |  |                       |  |           ^*****          | |                                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         ***      *** |  |                       |  |                           | |                                                  
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |  |                       |  |                           ***                                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                                                                                

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                              ||| | | | ||||       |^***         | |        | | |    |          ||||          | |||         ^***|           | | | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                              ||| | | | ^**|       ^**           | |        | | |    |          ||||          | |||           ^**           ^** | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                              ||| | | | ^***                     | |        | | |    |          ||||          | |||                             | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                              |^***** |  |                       | |        | | ^*****          ||||          | |||                             | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              | | | | ****                       | |        | |                 ||||          ****|                             | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              | | *** |  |                       | |        ***                 ||||            ***                             | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***     |  |                       | |                            ****                                            ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       | |                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                                 

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                         | |  ||||  | | ||||       |^***         | ||          ||||  |          ||||                  |  |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                         | |  ||||  | | ^**|       ^**           | ||          ||||  |          ||||                  |  |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                         | |  ||||  | | ^***                     | ||          ||||  |          ||||                  |  |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                         | |  |^***** |  |                       | ||          |^*****          ||||                  |  |                           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | |  ||||    |  |                       | ||          ||||             ||||                  ****                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         ***  ||||    |  |                       | ||          ***|             ||||                                                 
search RasMol script viewer Motif-ligand binding stats  nest ..                              ****    |  |                       | ||           ***             ****                                                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                                 

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                               | |  | | ||||       |^***         | ||           | |  |                         | |          ^***||  ||      | |   | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                               | |  | | ^**|       ^**           | ||           | |  |                         | |            ^**|  ||      ^**   | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                               | |  | | ^***                     | ||           | |  |                         | |               |  ||            | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                               ^***** |  |                       | ||           ^*****                         | |               |  ||            | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               | |    |  |                       | ||             |  |                         | |               *****            | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               | |    |  |                       | ||             |  |                         | |               ****             | |
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    |  |                       | ||             |  |                         | |                                ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****             ****                         ***                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                                 

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                               | |  | | ||||       |^***         | ||        | |||   |        |  |                    |  |  ^***|           | || |   
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                               | |  | | ^**|       ^**           | ||        | |||   |        |  |                    |  |    ^**           ^**| |   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                               | |  | | ^***                     | ||        | |||   |        |  |                    |  |                     | |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                               ^***** |  |                       | ||        | |^*****        |  |                    |  |                     | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               | |    ****                       | ||        | | |            |  |                    ****                     | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                               | |    |  |                       | ||        | ***            |  |                    |  |                     ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    |  |                       | ||        | |              |  |                    |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****        ***              ****                    ****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                                 

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                              ||| | | | ||||       |^***         |  |          || | || |  | |     | |         |  |    |  |  ^***|           | |  | | 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                              ||| | | | ^**|       ^**           |  |          || | || |  | |     | |         |  |    |  |    ^**           ^**  | | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                              ||| | | | ^***                     |  |          || | || |  | |     | |         |  |    |  |                       | | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                              |^***** |  |                       |  |          |^***** |  | |     | |         |  |    |  |                       | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              | | *** |  |                       |  |          |  | |  |  | |     ***         |  |    |  |                       | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***     |  |                       |  |          |  | |  |  | |                 |  |    |  |                       *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****          **** ****  ***                 ****    ****                           

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..      | |        ||||  | |    |||   | | ||||       |^***|        |  |          |||   |                        |  |          ^***|           | |   | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      | |        ||||  | |    |||   | | ^**|       ^**| |        |  |          |||   |                        |  |            ^**           ^**   | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |        ||||  | |    |||   | | ^***          | |        |  |          |||   |                        |  |                                | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |        ||||  | |    |^***** |  |            | |        |  |          |^*****                        |  |                                | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***        ***|  ***    | |     |  |            ***        |  |          ***                            |  |                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                  | |         ***     |  |                       |  |                                         |  |                                ***
search RasMol script viewer Motif-ligand binding stats  niche ..                  ***                 ****                       ****                                         ****                                   

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                               |    | | ||||       |^***         |  |          || |  |    | |  | |    |  |             | |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                               |    | | ^**|       ^**           |  |          || |  |    | |  | |    |  |             | |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                               |    | | ^***                     |  |          || |  |    | |  | |    |  |             | |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                               ^***** |  |                       |  |          |^*****    | |  | |    |  |             | |                           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                      |  |                       |  |          ****       | |  | |    ****             | |                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                      |  |                       |  |          |  |       | |  ***                     | |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                       ****          ****       ***                          ***                           

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                    | |        |  | | | ||||       |^***| |      |  |       | | |    |    | || |                      |  |  ^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                    | |        |  | | | ^**|       ^**| | |      |  |       | | |    |    | || |                      |  |    ^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                    | |        |  | | | ^***          | | |      |  |       | | |    |    | || |                      |  |                           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                    | |        ^***** |  |            | | |      |  |       | | ^*****    | || |                      |  |                           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |           *** |  |            | ***      |  |       ***           | |***                      |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***               ****            ***        ****                     ***                         ****                           

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                   ||||        |    | | ||||       |^***|        | ||           |    |        |  ||             ||||       |^***|           | |      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                   ||||        |    | | ^**|       ^**|||        | ||           |    |        |  ||             ||||       | |^**           ^**      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                   ||||        |    | | ^***         ||||        | ||           |    |        |  ||             ||||       | |                       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                   ||||        ^***** |  |           ||||        | ||           ^*****        |  ||             ||||       | |                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   ||||               |  |           ||||        | ||                         *****             ||||       | |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ||||               ****           ||||        | ||                         ****              ||||       | |                       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   ||||               |  |           ***|        | ||                                           |***       ***                       
search RasMol script viewer Motif-ligand binding stats  nest ..                   ****               |  |            | |        | ||                                           ***                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****            ***        ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                                 

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HYPOTHETICAL PROTEIN
sec str:  ...................................ee........eeeeeee.........ee.eee.....eee..................ee.......eehhhhh.eeee.............eeee.....eeee..ee.......
sequence :  ..MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                         | |   | |  | | ||||       |^***         |  |    | |    |   || |                        ||||        ^***|| ||||     | | | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                         | |   | |  | | ^**|       ^**           |  |    | |    |   || |                        ||||          ^**| ||||     ^** | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                         | |   | |  | | ^***                     |  |    | |    |   || |                        ||||             | ||||         | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                         | |   ^***** |  | |                     |  |    | |    ^***** |                        ||||             | ||||         | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         | |   | |    |  | |                     |  |    | |        |  |                        ||||             | ||||         ***  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | |   | |    **** |                     |  |    | |        |  |                        ||||             ****||              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         ***   | |    |  | |                     |  |    | |        |  |                        |***               ||||              
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    |  | |                     |  |    | |        |  |                        ****               ****              
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ******                     ****    ***        ****                                                             

   New search    2jqa:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML