triangle PDBeMotif: 2jgk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Tue, Feb 13, 2007
Title crystal structure of mouse acetylcholinesterase inhibited by aged fenamiphos
Authors A.-K.TUNEMALM, A.HORNBERG, F.EKSTROM
Method X-RAY DIFFRACTION (resolution: 2.90Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search P6G P6G binding statistics P6G
Modified residues:  search SVZ SVZ binding statistics SVZ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135/searchPF08674PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
JMol viewer RasMol script viewer  P6G 1542B  ..                                                                                                                                                                                                                                                                 ..P6G ..                                                                                                                   **                                                                                                                                                 *       *       
JMol viewer RasMol script viewer  NAG 1544A  ..                                                                                                                                                                                                                                                                 ..NAG ..                                                                                  *  *                             ||                                                                                                                                                 |       |       
sec str:  ......hhh.eeee..eeee.eeeee..eeeeeeeeee.....hhhhh............eee......ee..........hhhhhh......ee....eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee..........eehhhhhhhhhhhhhhhh.... ..hhhhhhhhhhh.hhhhhhhhh................ee.......hhhhhhh.......eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....................eeeee.....eeee..hhhhhhhhhhhhhhh...
sequence :  ..EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGC... ..NDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251    ... ..265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|||| |  |  |  |    |     |    || ||   || ||||| |         |    |             |  |  ||  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      |  |||| ||   | |||..PS00001..^***   || ||    |  || |       | |      |||||       |  | |  |         |        |  || |^*** |   |  |    |  |        ||  |   |  |   |                          | |      | | |  | |    | |||||  | |||  | ||^*** |       |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|||| |  |  |  |    |     |    || ||   || ||||| |         |    |             |  |  ||  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      |  |||**^*   | |||..PS00004..   |   || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |  |    |  |        ||  |   |  |   |                          | |      | | |  | |    | |||||  | |||  | || ||  |       |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|||| |  |  |  |    |     |    || ||   || ||^** |         |    |             |  |  ||  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      |  |||   |   | |||..PS00005..   |   || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |  |    |  |        ||  |   |  |   |                          | |      | | |  | |    | |||||  | |||  | || ||  |       |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|||| |  |  |  |    |     |    || ||   || || || |         |    |             |  |  ||  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      ^***||   |   | |||..PS00006..   |   || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |  |    |  |        ||  |   |  |   |                          | |      | | |  | |    | |||||  | |||  | || |^***       |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|||| |  |  |  |    |     |    || ||   || || || |         |    |             |  |  ||  |  ********^     |                |||||||  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      |   ||   |   | |||..PS00007..   |   || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |  |    |  |        ||  |   |  |   |                          | |      | | |  | |    | |||||  | |||  | || |           |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|||| |  |  |  ^*****     ^*****| ^*****| || || |         ^*****             |  |  ||  |     |||| |     |                ^*****|  ||  |       | |           |  | |  |     | |              || |||| |||     ||||||   |  |               | |      |   ||   |   | |^*..PS00008..****   || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |  ^*****  |        ||  |   |  |   |                          | |      | | |  | |    ^*****|  | |||  | || |           |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..|||| |  |  |  |                |  |    | || || |                            |  |  ||  |     |||| |     |                ||||| |  ||  |       | |           |  | |  |     | |              || *************^**|||   |  |               | |      |   ||   |   | |||..PS00122..       || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |       |  |        ||  |   |  |   |                          | |      | | |  | |      |||||  | |||  | || |           |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..|||| |  |  |  |                |  |    | || || |                            |  |  ||  |     |**^********                ||||| |  ||  |       | |           |  | |  |     | |              || |||| |||     || |||   |  |               | |      |   ||   |   | |||..PS00941..       || ||    |  || |       | |      |||||       |  | |  |         |        |  || ||||| |   |       |  |        ||  |   |  |   |                          | |      | | |  | |      |||||  | |||  | || |           |   |    | | || | | |         | |    | |        | ||  ||    |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|||| |  |  |  |                |  |    | || || |                            |  *****  |     | || |                      ||||| |  ||  |       | |           |  | |  |     | |              || |||| |||     *****|   |  |               | |      |   ||   |   | |||..alphabetamotif..       || ||    ***** |       | |      |||||       |  | |  |         |        |  || ||||| |   |       |  |        ||  |   |  |   |                          | |      | | |  | |      |||||  | |||  | || |           |   |    | | || | | |         | |    | |        | |*****    |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|||| |  |  |  |                |  |    | || || |                            |  |  ||  |     | || |                      ||||| |  ||  |       | |           |  | |  |     | |              || |||*****     || | |   |  |               | |      |   ||   |   | |||..asxmotif..       || ||    |  |  |       | |      |||||       |  | |  |         |        |  || ||||| |   |       |  |        ||  |   |  *****                          | |      | | |  | |      |||||  | |||  | || |           |   |    | | || | | |         | |    | |        | ||  |     |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..|||| |  |  |  |                |  |    | || || |                            |  |  ||  |     | || |                      ||||| |  ||  |       | |           |  | |  |     | |              || |||***|      || | |   |  |               | |      |   ||   |   | |||..asxturn..       || ||    |  |  |       | |      |||||       |  | |  |         |        |  || |***| |   |       |  |        ||  |   |  |                              | |      | | |  | |      |||||  | |||  ***| |           |   |    | ****** | |         | |    ***        | ||  |     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..|||| |  |  ****                |  |    | *******                            ***********     | || |                      ****| |  ||  |       | |           |  | ****     | |              *****|****      **** |   |  |               | |      |   ||   |   ****|..betaturn..       *****    *******       | |      |||||       |  | |  |         |        ****| ||||| |   |       |  |        ||  |   |  |                              | |      | | **** |      ****|  ****|  |  | |           |   |    | | |    | |         | |    | |        | |****     ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***| |  |                      |  |    ***| || |                            |  |   |  |     | |***                      ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |               | |      |   ||   |     | |..gammaturn..        |  |                  | |      |||||       |  | |  |         |        |  || ||||| |   |       |  |        ||  |   |  |                              | |      | | |  | |       || |    |||  |  | |           |   |    | | |    | |         | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  nest .. | | |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |               | |      |   ||   |     ***..nest..        |  |                  | |      ****|       |  | |  |         |        |  || ||*** |   |       |  |        ||  |   |  |                              ***      | | |  | |       |***    ***  |  ***           |   |    *** |    | |         ***    | |        ***               
search RasMol script viewer Motif-ligand binding stats  niche .. *** ****                      ****       ******                            ****   ****     | |                         ||    ********                     **** ****                                      ||   |   ****               ***      |   ||   |        ..niche..        ****                  ***        ***       **** ****         |        ******** |  |   |       ****        |****   ****                                       *** ******       |        |****                |   |    | ***    ***                ***                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                            | |                         ||                                                                                ||   |                               *****|   |        ..stmotif..                                                                     |            | |  |  *****                   |   |                                                               |        |                    |   |    | |                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                            | |                         ||                                                                                |*****                                    *****        ..ststaple..                                                                     |            ******                          *****                                                               |        |                    *****    | |                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                            ***                         ||                                                                                ||                                                     ..stturn..                                                                     |            ***                                                                                                 |        |                             ***                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                        **                                                                                **                                                     ..REP00000..                                                                     *                                                                                                                *        *                                                                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135/searchPF08674PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
sec str:  ...hhh.eeee..eeee.eeeee..eeeeeeeeee.....hhhhh............eee..................hhhhhh............eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee..........eehhhhhhhhhhhhhhh..... ..hhhhhhhhhhh.hhhhhhhhhhhh.............ee.......hhhhhhhhh.....eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....................eeeee.....eeee..hhhhhhhhhhhhhhhh
sequence :  ..EDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGC... ..NDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLL
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254 ... ..265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |||||  |  |    |     |    || ||   || ||||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  | |  |  | ||   |  | ..PS00001..^***    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  ^***        |    |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||^***|||||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |||||  |  |    |     |    || ||   || ||||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  | |  |  **^*   |  | ..PS00004..   |    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |        |    |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| |||||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||||  |  |    |     |    || ||   || ||^** |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  | |  |         |  | ..PS00005..   |    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |        |    |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| |||||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |||||  |  |    |     |    || ||   || || || |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  | ^***         |  | ..PS00006..   |    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |        |    |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||^***|||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |||||  |  |    |     |    || ||   || || || |         |    |             |  |   |  |  ********^     |                |||||||  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  | ..PS00007..   |    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |        |    |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| | |||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |||||  |  ^*****     ^*****| ^*****| || || |         ^*****             |  |   |  |     |||| |     |                ^*****|  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  ^*..PS00008..****    |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |        ^*****  |        ||  || ||  |                              | |      | | |  | | |  ^*****|    |||  | ||||| | |||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. |||||  |  |                |  |    | || || |                            |  |   |  |     |||| |     |                ||||| |  ||  |       | |        |  |  | |  |     | |              || *************^**  |   |  |  || ||            |  |              |  | ..PS00122..        |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |             |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| | |||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. |||||  |  |                |  |    | || || |                            |  |   |  |     |**^********                ||||| |  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  | ..PS00941..        |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |             |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| | |||    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |||||  |  |                |  |    | || || |                            |  |   |  |     | || |                      ||||| |  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  | ..alphabetamotif..        |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |             |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  | ||||| *****    |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. *****  |  |                |  |    | || || |                            |  |   |  |     | || |                      ||||| |  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  | ..asxmotif..        |  |         |  | | | | |      |||||  |   ||  |              |   | || |  ||  || |             |  |        ||  || ||  |                              | |      | | |  | | |  | |||||    |||  *****|| | ||     |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***||  |  |                |  |    | || || |                            |  |   |  |     | || |                      ||||| |  ||  |       | |        |  |  | |  |     | |              || |||         ||||  |   |  |  || ||            |  |              |  | ..asxturn..        |  |         |  | | | | |      ***||  |   ||  |              |   | || |  ||  || |             |  |        ||  |***|  |                              | |      | | |  | | |  | |||||    |||  ***| || | ||     |   |    | | |                | |    | |        | |         |  |
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  ****                |  |    | || || |                            ****   ****     | || |                      ****| |  ||  |       | |        ****  | ****     | |              *****|         ****  |   |  |  ****|            |  |              **** ..betaturn..        |  |         |  | | | | |      |||||  |   ||  |              |   | || ****|  || |             |  |        ||  |   |  |                              | |      | | |  | | **** ****|    |||  **** || ****     |   |    | | |                | |    | |        | |         ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |                      |  |    ***| || |                            |  |   |  |     | |***                      ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |            |  |                   ..gammaturn..        |  |         |  | *** | |      |||||  |   ||  |              |   | || |  ||  || |             |  |        ||  |   |  |                              | |      | | |  | |       || |    |||  |  | ||   |      |   |    | | |                | |    | |        | |             
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |            |  |                   ..nest..        |  |         |  |     | |      ****|  |   ||  |              |   | || |  ||  |***             |  |        ||  |   |  |                              ***      | | |  | |       |***    ***  |  ***|   |      |   |    *** |                ***    | |        ***             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                      ****       ******                            ****   ****     ***                         ||    ********                     **** ****                                      ||   |   ****   ****            ****                   ..niche..        ****         ****     ***        ***  |   |****              |   *************                ****        |****   ****                                       *** ******       |        |****     |   |      |   |    | ***                       ***                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                         | |                         ||                                                                                ||   |                                                 ..stmotif..                                              *****                  |                                            |   |                                                               |        |         *****      |   |    | |                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                         | |                         ||                                                                                |*****                                                 ..ststaple..                                                                     |                                            *****                                                               |        |                    *****    | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                         ***                         ||                                                                                ||                                                     ..stturn..                                                                     |                                                                                                                |        |                             ***                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     **                                                                                **                                                     ..REP00000..                                                                     *                                                                                                                *        *                                                                                    

   New search    2jgk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors