triangle PDBeMotif: 2jef  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.7
Classification transferase/dna    | release date: Wed, Jan 17, 2007
Title the molecular basis of selectivity of nucleotide triphosphate incorporation opposite o6-benzylguanine by sulfolobus solfataricus dna polymerase iv: steady-state and pre-steady-state and x-ray crystallography of correct and incorrect pairing
Authors F.P.GUENGERICH, I.D.KOSEKOV, K.C.ANGEL, M.EGLI, R.L.EOFF
Method X-RAY DIFFRACTION (resolution: 2.17Å)
PDBe Citation   
Small molecules:    search DGT DGT binding statistics DGT   search CA CA binding statistics CA
Modified residues:  search BZG BZG binding statistics BZG search DOC DOC binding statistics DOC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA POLYMERASE IV
member of: CATH:search1.10.150.20/search3.30.1490.100/search3.30.70.270GENE3D:searchG3DSA_1.10.150.20/searchG3DSA_3.30.1490.100/searchG3DSA_3.30.70.270HAMAP:searchMF_01113PANTHER:searchPTHR11076PFAM:searchPF00817/searchPF11798/searchPF11799PROSITE PROFILES:searchPS50173, SUPERFAMILY:searchSSF100879/searchSSF56672UniProt:searchQ97W02
JMol viewer RasMol script viewer  CA 1346A  ..                                                                                                                                                                                     *    *                                                                                                                                                            
JMol viewer RasMol script viewer  CA 1345A  ..       **                                                                                                *                                                                           |    |                                                                                                                                                            
JMol viewer RasMol script viewer  CA 1344A  ..       *|                                                                                                **                                                                          |    |                                                                                                                                                            
JMol viewer RasMol script viewer  DGT 1343A  ..       |*****                               **  *  *                                                     *|                                                    *                     |    |                                                                                                                                                            
sec str:  .....eeeeee.hhhhhhhhhhhhhhh...eeeeee.......eeeeeehhhhhh.......hhhhhhhhh...eeee.hhhhhhhhhhhhhhhhh.....eeeee..eeeee.hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhh...eee.hhhhhhhhhhhh.hhhh...hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............eeeeeeeeeeee.hhhhhhhhhhhhhhhhhhhhh...eeeeeeeeee....eeeeeee.....hhhhhhhhhhhhhhhhhhhh...eeeeeeeeeee..
sequence :  ..HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 |  ||||| |       ||||   |  |||    | ||||  |        |  |             | |    |  || |    | ||   | | |                     | |    |   ||  |    |  |               |  ||||||  ||^***| || |||  |  |  ||  ||  ||            ||||                | | ||||      |  |      | || |          | |||            |   |   | |     |  | |  || |    |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                 |  ||||| |       ||||   |  |||    | ||||  |        |  |             | |    |  || |    | ||   | | |                     | |    |   ||  |    |  |               |  ||||||  ||    | || |||  |  |  ||  ||  ||            ||||                | **^*||      |  |      | || |          | |||            |   |   | |     |  | |  || |    |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 |  ||^** |       ^**|   |  |||    | ||||  |        |  |             ^**    |  |^**    | ||   | ^**                     | |    |   ||  |    |  |               |  ||||||  ||    | || |||  |  |  ||  ||  ||            ||||                ^**  |||      |  |      | || |          | |||            |   |   ^**     |  | |  || |    |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |  || || |       ||||   |  |||    | ||||  |        |  |                    |  || |    ^***   | |                       | |    |   ||  |    |  |               |  ||||||  ||    | || |||  |  |  ||  ||  ||            ||||                     |||      |  |      | || |          | |||            |   |           |  | |  || |    |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                 |  || || |       ||||   |  |||    | ||||  |        |  |                    |  || |    | ||   | |                       | |    |   ||  |    |  |               |  ||||||  ||    | || |||  |  |  ||  ||  ||            ||||                     |********^  *******^ || |          | |||            |   |           |  | |  || |    |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  || || |       ||||   ^*****    | |^*****        |  |                    |  || |    | ||   | |                       | |    ^*****  |    |  |               |  ||||||  |^***** || |||  |  |  ||  ||  ||            ||||                     | |                  || |          | |||            |   |           |  | |  || ^*****   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  || || |       ||||      ||     | ||||  |        |  |                    |  || |    | ||   | |                       | |        |   |    |  |               |  ||||||  |       || |||  |  |  |*********            ||||                     | |                  || |          | |||            |   |           |  | |  ||          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  || || |       ||||      ||     | ||||  |        |  |                    |  || |    | ||   | |                       | |        *****    |  |               |  |*****  |       || |||  |  |  ||  ||  |             ||||                     | |                  || |          | |||            |   |           |  | |  ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  || || |       ||||      ||     | ||||  |        |  |                    |  || |    | ||   ***                       | |                 |  |               |  |***||  |       || |||  |  |  ||  ||  |             ||||                     | |                  || |          | |||            |   |           |  | |  ||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  || || |       ||||      **     | ||||  |        |  |                    |  || |    | ||                             | |                 |  |               |  ||| ||  |       || |||  |  |  ||  ||  |             ||||                     | |                  || |          | |||            |   |           |  | |  **          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  || || |       ||||             | ||||  |        |  |                    |  || |    | ||                             | |                 |  |               |  ||| ||  |       || |||  |  |  ||  ||  |             ||||                     | |                  || |          *****            |   |           |  | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 **********       ||||             ****||  |        |  |                    ****| |    | ||                             | |                 |  |               |  |********       |****|  ****  |********             ||||                     | |                  ****          ****|            |   |           |  | |              
search RasMol script viewer Motif-ligand binding stats  nest ..                     | || |       ****               ***|  |        |  |                        | |    | ||                             ***                 |  |               |  | |  |  |       |  ***     |  |                     ****                     | |                   | |            ***            |   |           |  | |              
search RasMol script viewer Motif-ligand binding stats  niche ..                     ******                             ****        ****                        ***    ****                                                 ****               **** *******       |    |     ****                      ***                     | |                   ***                           |   |           ******              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                       | |                                                                                        ******                                                       | |                                                 |   |                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                       | |                                                                                                                                                     | |                                                 *****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                       ***                                                                                                                                                     ***                                                                                     

chain P : 5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*TP*TP*CP*DOC)
JMol viewer RasMol script viewer  CA 1346A  ..              
JMol viewer RasMol script viewer  CA 1344A  ..              
JMol viewer RasMol script viewer  DGT 1343A  ..             *
sec str:  ................
sequence :  ..GGGGGAAGGATTCC
seq num:  ..1         11  

chain T : 5'-D(*TP*CP*AP*CP*BZGP*GP*AP*AP*TP*CP*CP*TP*TP*CPCP*CP*C)-3';
JMol viewer RasMol script viewer  DGT 1343A  .. **             
sec str:  ..................
sequence :  ..ACGGAATCCTTCCCCC
seq num:  ..3         13    

   New search    2jef:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors