triangle PDBeMotif: 2j2c  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.5
Classification hydrolase    | release date: Wed, Aug 16, 2006
Title crystal structure of human cytosolic 5'-nucleotidase ii (nt5c2, cn-ii)
Authors A.EDWARDS, A.FLORES, A.G.THORSELL, A.MAGNUSDOTTIR, B.M.HALLBERG, C.ARROWSMITH, C.PER, D.OGG, H.BERGLUND, J.SAGEMARK, J.UPPENBERG, J.WEIGELT, K.WALLDEN, L.HOLMBERG SCHIAVONE, M.EHN, M.HAMMARSTROM, M.HOGBOM, M.SUNDSTROM, M.WELIN, P.LOPPNAU, P.NILSSON-EHLE, P.NORDLUND, P.STENMARK, R.BUSAM, R.COLLI, S.FLODIN, S.GRASLUND, S.VAN DEN B, T.KARLBERG, T.KOT, T.NYMAN
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GOL GOL binding statistics GOL   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYK
SPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKF
IQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVEN
LEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTV
LRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHV
WTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLY
AASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOSOLIC PURINE 5'-NUCLEOTIDASE
member of: GENE3D:searchG3DSA_3.40.50.1000PANTHER:searchPTHR12103/searchPTHR12103_SF17PFAM:searchPF05761PIRSF:searchPIRSF017434SUPERFAMILY:searchSSF56784TIGRFAMS:searchTIGR02244UniProt:searchP49902
JMol viewer RasMol script viewer  MG 1496A  ..                                                 * *                                                                                                                                                                                                                                                                                                        *                                                 ..MG ..                                                                        
JMol viewer RasMol script viewer  SO4 1495A  ..                                                 | |                     *                                                                                                                                  *                                                                                                                                               |                                                 ..SO4 ..                                                                        
JMol viewer RasMol script viewer  SO4 1494A  ..                                                 | |                     |                                                     **  *     *                                                                  |                                                                                                                                               |                                                 ..SO4 ..                                                                        
JMol viewer RasMol script viewer  SO4 1493A  ..                                                 | |                     |                                        *            ||  |     |                                                                  |                                                                                                                                               |                                                 ..SO4 ..                             *                                          
JMol viewer RasMol script viewer  SO4 1492A  ..                      *  **                      | |                     |                                        |            ||  |     |                                                                  |                                                                                                                                               |                                                 ..SO4 ..                             |                            *  *          
JMol viewer RasMol script viewer  SO4 1491A  ..                      |  ||                      | |                     |                                        |            ||  |     |                                                                  |                                          *                                                                                                    |                                                 ..SO4 ..                             |                            |  |          
JMol viewer RasMol script viewer  SO4 1490A  ..                      |  ||                      | |                     |                                        |            ||  |     |   *                                                              |                                          |                                                                                                    |                                                 ..SO4 ..                             |      *  **                 |  |          
JMol viewer RasMol script viewer  GOL 1489A  ..                      |  ||                      | |                     |                   **                   |            ||  |     |   |                                                              |                                          |                                                                                                    |                      *   *                      ..GOL ..                 *           |      |  ||                 |  |          
sec str:  ...hhhhhhhhhhh.....hhhhhhhhhhhhhhh.ee...ee.hhh.eeee...........hhhhhhhhhhhhhhhhhh..hhhhhhh...........eee....eeeee.....eeeeee..ee.hhhhhh...............eee..hhhhhhhhhhhhhhhhhhhhh...ee...eeee..eeeehhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhheeeee...hhhhhhhhhhhhh.............hhhhhh.eeee....hhhhh....eee......................eee.hhhhhhhhhh.hhh.eeeee.hhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhh... ..hhhhhhhhhhhhhhhhh........ee..eehhhhhhhhhhh.eee.hhhhhhhh....ee......hhhhh
sequence :  ..TSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLA... ..SSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHES
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393     ... ..417       427       437       447       457       467       477         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |||   |  |  | |   |  |  || ||   ^*** |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||  |  | |||   | |||  |      |  || |  ||  |          | |      |       |  |||| |    |  |                      | ||   |||  || |||    |  || |  || ||    |||||| ||        | || |          | ||   ||   || | | |||  | | | |   |   | | | |                | | |  |          ..PS00001..       | ||       |  ||||  | | ||  |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |||   |  |  | |   |  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||  |  | |||   | |||  |      |  || |  ||  |          | |      |       |  |||| |    |  |                      | ||   |||  || |||    |  || |  || ||    |||||| ||        | || |          | ||   ||   || | | |||  | | | |   |   | | | |                | | |  |          ..PS00004..       **^*       |  ||||  | | ||  |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ^**   |  |  | |   |  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||  |  ^**||   | |||  |      |  || |  ||  |          ^**      |       |  ^**| |    |  |                      | ||   ^**  || |||    |  |^**  || ||    |||||| ||        | |^**          | ||   ||   || | | |||  | | | |   |   ^** | |                ^** |  |          ..PS00005..                  |  ||||  | | ||  |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***    |  |  | |   |  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||  |  |  ||   | |||  |      |  || |  |^***                   |       |  ^*** |    |  |                      ^***   ||   || |||    |  |     |^***    |||||| ||        | || |          | ||   ||   ^*** | |||  | | | |   |   |   | |                    ^***          ..PS00006..                  |  ||||  | | ||  |  |  |     | | || ||  |        |   ^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |     |  |  | |   |  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||  *******^   | |||  |      |  || |  |                       ********^   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          | ||   ||    |   | |******^ | |   |   |   | |                                  ..PS00007..                  |  ||||  | | ||  |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..** |     |  |  | |   |  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          | ^*****^*****   | | |  |   | |   |   |   | |                                  ..PS00008..                  ^*****|  ^*****  |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |     |  |  | |   |  |  *****        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          |  |             | | |  |   | |   |   |   | |                                  ..alphabetamotif..                  |  || |  | | |   |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |     |  |  | *****  |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  | || |    | | | ||   | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        | || |          |  |             | | |  |   | |   |   |   | |                                  ..asxmotif..                  |  || |  | | |   |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |     |  |  | |      |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  ***| |    *** | ||   | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        ***| |          |  |             | | |  |   | |   |   |   | |                                  ..asxturn..                  |  || |  | | |   |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |     |  |  | |      |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  |  | |      | | **   | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        |  | |          |  |             | | |  |   | |   |   |   | |                                  ..betabulge..                  |  || |  | | |   |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | |     |  |  | |      |  || ||        |  |      | |||     |   | |   |   || |||  || ||       |  |  ******      | |      | |          | |||     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   || |||    |  |     |  |     |||||| ||        ******          |  |             | | |  |   | |   |   |   | |                                  ..betabulgeloop..                  |  || |  | | |   |  |  |     | | || ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     |  |  | |      |  ****|        ****      ****|     |   | |   |   |****|  *****       |  |     | |      | |      | |          ****|     |  |    ****|  |      |  || |  |                                   |   |    |  |                      | ||   ||   |****|    ****     |  |     ||||*****           | |          |  |             | | |  |   | |   |   |   | |                                  ..betaturn..                  ****| |  | | |   |  |  |     | **** ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |     |  |  | |      |  ||  |        |  |        | |     |   | |   |   |  | |   |  |       |  |     | |      | |      | |            | |     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   |  ***    |  |     |  |     ||||                | |          |  |             | | |  |   | |   |   |   | |                                  ..gammaturn..                      | |  | | |   |  |  |     | | |  ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  nest .. | |     |  |  | |      |  ||  |        |  |        ***     |   | |   |   |  ***   |  |       |  |     ***      ***      | |            ***     |  |    | |||  |      |  || |  |                                   |   |    |  |                      | ||   ||   |         |  |     |  |     ****                ***          |  |             *** |  |   | |   |   |   ***                                  ..nest..                      | |  | | |   |  |  |     | | |  ||  |        |   |
search RasMol script viewer Motif-ligand binding stats  niche .. | |     ****  ***      ********        ****                |   | |   |   |    |   ****       ****                       ***                    ****    | |||  |      |  *******                                   |   |    ****                      ***|   ||   |         ****     ****                         | |          ****                 ****   ***   |   |                                        ..niche..                      | |  *** |   |  ****     | | ********        |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop .. | |                                                        |   | |   |   ******                                                                        | |||  |      |   |                                        |   |                              | ||   ||   |                                               | |                                            |   |                                        ..schellmannloop..                      | |      |   |           | |                 |   |
search RasMol script viewer Motif-ligand binding stats  stmotif .. | |                                                        |   | |   |                                                                                 *****  |      |   |                                        |   |                              | ||   ||   |                                               | |                                            |   |                                        ..stmotif..                      | |      *****           | |                 |   |
search RasMol script viewer Motif-ligand binding stats  ststaple .. | |                                                        ***** *****                                                                                 | |*****      *****                                        *****                              | |**********                                               | |                                            *****                                        ..ststaple..                      | |                      | |                 *****
search RasMol script viewer Motif-ligand binding stats  stturn .. ***                                                                                                                                                    ***                                                                                           ***                                                         ***                                                                                         ..stturn..                      ***                      ***                      

   New search    2j2c:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors