triangle PDBeMotif: 2izv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Wed, Jul 26, 2006
Title crystal structure of socs-4 in complex with elongin-b and elongin-c at 2.55a resolution
Authors A.BULLOCK, A.C.W.PI, A.E, A.TURNBULL, C.ARROWSMITH, E.PAPAGRIGORIOU, F.GORREC, F.VON DELFT, J.E.DEBRECZENI, J.WEIGELT, M.SUNDSTROM, S.KNAPP
Method X-RAY DIFFRACTION (resolution: 2.55Å)
PDBe Citation   
Small molecules:    search NA NA binding statistics NA   search EDO EDO binding statistics EDO   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MHHHHHHSSGVDLGTENLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRS
LHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALP
IPSSMKLYLKEYHYKSKVRVLRIDAPE
Chain B sequence:
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Chain C sequence:
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPPRESSOR OF CYTOKINE SIGNALING 4
member of: GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR10385/searchPTHR10385_SF29PFAM:searchPF00017/searchPF07525PROSITE PROFILES:searchPS50001/searchPS50225, SMART:searchSM00252/searchSM00253/searchSM00969SUPERFAMILY:searchSSF158235/searchSSF55550UniProt:searchQ8WXH5
JMol viewer RasMol script viewer  CL 1432A  ..                                                                                                                            *                                      
JMol viewer RasMol script viewer  EDO 1431A  ..                                             **     *                                                                       |                             **       
JMol viewer RasMol script viewer  NA 1430A  ..                                             |* *  *|                                                                       |                             ||       
sec str:  ......eeee..hhhhhhhh..eeee.hhhhhhhhhh.....eeeeee.......eeeeeee..eeeeee.eee..eee............hhhhhhhhh.hhhhh........ee.......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh..eeee...
sequence :  ..NLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVR
seq num:  ..267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  | ||    |   | | || ||  |     | || |    | |||||           ^***|  |  |         | || ||  ||  |             |   |     |^*** | |  |    | |             
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  | ||    |   | | || ||  |     | || |    | **^*|             | |  |  |         | || ||  ||  |             |   |     |  || | |  |    | |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  | ||    |   | | || ||  |     | || |    ^**|  |             | |  |  |         | || ||  ||  |             |   |     |  || | |  |    ^**             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  | ||    |   | | || ||  |     ^*** |       |  |             | |  |  |         | || ||  ||  |             |   |     |  ^*** |  |                    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  | ||    |   | | || ||  |     | |  |       |  |             | |  |  |         | || ||  ||  |             |   |     |  ||   |  |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              |  | ||    ***** | || ||  |     | |  |       |  |             | |  |  |         | || ||  ||  |             |   |     |  ||   |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  ***|          | || ||  |     | |  |       |  |             | |  |  |         | || ||  ||  |             |   |     |  ||   |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****  |          | ********     | |  |       ****             | |  |  |         **** ||  ||  |             |   |     |  ||   |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..              *******          **********     ******                        | *******           ************             |   |     ****|   ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              | |                           | |                                          *****         *****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                           ***                                                                                    

chain B : TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR13248PFAM:searchPF00240PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchQ15370
sec str:  ...eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee......................eeeeeeeee..ee..............hhhhh.
sequence :  ..MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
seq num:  ..1         11        21        31        41        51        61        71        81        91        101  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |  ||  ||       | ||| ||  | | |  |  ||||||||| |^**  |          | |          |  | || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                  |  |^***|       | ||| ||  | | |  |  |^***|||| ||||  |          | |          ^*** || || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                  |  ||   |       | ********^ | |  |  |||| |||| ||||  |          | |               || || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  |  ||   |       | ||| ||    | |  |  |||| |||| ||||  |          | |               || || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  |  ||   |       | ||| ||    | |  |  |||| |||*****|  |          | |               || || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  |  ||   |       | |****|    | |  ****||****|****|****          | |               ****| 
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  ||   |       *** |  |    | |  |  |||  ***| | |              | |                |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****|   |           ****    ***  ****||  | || | |              ***                **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                      |   |                            |******| | |                                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                      *****                            *****  *****                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              ***                                        

chain C : TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 1
member of: CATH:search3.30.710.10GENE3D:searchG3DSA_3.30.710.10PANTHER:searchPTHR20648PFAM:searchPF03931SMART:searchSM00512SUPERFAMILY:searchSSF54695UniProt:searchQ15369
sec str:  ...eeeee.....eeeeehhhhh.hhhhhhh....eee....hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.
sequence :  ..MYVKLISSDGHEFIVKREHALTSGTIKAML..NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
seq num:  ..17        27        37        ..58        68        78        88        98        108  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | |         | ||| | | ..*   |  | |   |  |   | ||  |^***|                    | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |         | ||^** | ..    |  | |   |  |   ^**|  | |  |                    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |         | ||  | | ..    |  | |   |  |   | ||  | ^***                    | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |         | |^***** ..    |  | |   |  |   | ||  |                         | |
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         | |   |   ..    |  | |   |  |   | ||  |                         ***
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   |   ..    **** |   |  |   | |****                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                      *****   ..         |   |  |   | |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              ..         *****  ***** *****                            

   New search    2izv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors