triangle PDBeMotif: 2imt  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification apoptosis    | release date: Wed, Oct 4, 2006
Title the x-ray structure of a bak homodimer reveals an inhibitory binding site
Authors A.TOCILJ, G.C.SHORE, K.B.GEHRING, M.WATSON, Q.LIU, T.MOLDOVEANU
Method X-RAY DIFFRACTION (resolution: 1.49Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQT
MLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRG
GWVAALNLGNG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAK
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF41PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ16611
JMol viewer RasMol script viewer  ZN 200A  ..                                                                                                                                           *   *                   
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh
sequence :  ..SASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNL
seq num:  ..21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   |^*** |    |        |        | | | |             |||| |   |||  |||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   | |   ^*****        |        | | | |             |||| |   |^*****|  
search RasMol script viewer Motif-ligand binding stats  BH1 ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   | *******************        | | | |             |||| |   | |  | |  
search RasMol script viewer Motif-ligand binding stats  BH2 ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   |                            | | | |             |||| ************  
search RasMol script viewer Motif-ligand binding stats  BH3 ..  |   |   |                   |  |  |||||||  |  |   |***************        |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |   |                   |  |  |*****|  |  |   |                       |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |   |   |                   |  |  ***|| |  |  |   |                       |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |   |                   ****   **** |  |  |   |                       ****       |   |   |                            | | | |             ||||     | ****    
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |   |                   |  |     |  |  |  |   |                       |  |       |   |   |                            *** ***             ****     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |   |                   ****     ****  ****   |                       ****       |   |   |                                                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****   |                                     *****                                  |   |   |                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****                                                                            *********                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BAK
member of: CATH:search1.10.437.10GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF41PFAM:searchPF00452PRINTS:searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01259, PROSITE PROFILES:searchPS50062, SMART:searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ16611
JMol viewer RasMol script viewer  ZN 200A  ..                                                                                                                                           *   *                   
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh
sequence :  ..SASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNL
seq num:  ..21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   |^*** |    |        |        | | | |             |||| |   |||  |||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   | |   ^*****        |        | | | |             |||| |   |^*****|  
search RasMol script viewer Motif-ligand binding stats  BH1 ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   | *******************        | | | |             |||| |   | |  | |  
search RasMol script viewer Motif-ligand binding stats  BH2 ..  |   |   |                   |  |  |||||||  |  |   ||             |        |  |       |   |   |                            | | | |             |||| ************  
search RasMol script viewer Motif-ligand binding stats  BH3 ..  |   |   |                   |  |  |||||||  |  |   |***************        |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |   |                   |  |  |*****|  |  |   |                       |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |   |   |                   |  |  ***|| |  |  |   |                       |  |       |   |   |                            | | | |             ||||     | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |   |                   ****   **** |  |  |   |                       ****       |   |   |                            | | | |             ||||     | ****    
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |   |                   |  |     |  |  |  |   |                       |  |       |   |   |                            *** ***             ****     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |   |                   ****     ****  ****   |                       ****       |   |   |                                                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****   |                                     *****                                  |   |   |                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****                                                                            *********                                                                   

   New search    2imt:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors