triangle PDBeMotif: 2il1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Mon, Oct 2, 2006
Title crystal structure of a predicted human gtpase in complex wit
Authors A.BOCHKAREV, A.M.EDWARDS, C.H.ARROWSMITH, CONSORTIUM (SGC), H.PARK, J.WANG, J.WEIGELT, M.SUNDSTROM, R.LANDRY, STRUCTURAL GENOMIC, W.TEMPEL, Y.SHEN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP   search UNX UNX binding statistics UNX   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIW
DTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQ
ITGMRFCEASAKDNFNVDEIFLKLVDDILKKM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAB12
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF417PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchQ6IQ22
JMol viewer RasMol script viewer  UNX 1406A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1405A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1404A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1403A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1402A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1401A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  GDP 401A  ..             ** ****       ..                                                                                  ** **                          ***                    
JMol viewer RasMol script viewer  CA 501A  ..             || ||||       ..                                                                                  || ||                          |||     **             
JMol viewer RasMol script viewer  MG 402A  ..             || ||*|       ..                                                                                  || ||                          |||     ||             
sec str:  .....eeeeeeee.....hhhhhhhhhh.......eeeeeeeeee..eeeeeeeeee..hhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhh..hhhhhhhhhhh....eeee.......hhhhhhhhhhhhhhhh.
sequence :  ..PADFKLQVIIIGSRGVGKTSLMERFTD..STVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKM
seq num:  ..134       144       154    ..169       179       189       199       209       219       229       239       249       259       269       279       289       299   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  |||||| ||  | .. |  |        || ||        | |          | |||      | |**^*  |        |  ||  |       | |||| ||         |  | ||   | | || || |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |||||| ||  | .. |  |        || ||        | |          | ^**      | ^**||  |        |  ||  |       | |||^**|         |  | ||   | ^**| || |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |||||^***  | .. |  |        || ||        | |          |  |       | ^***^***        |  ||  |       | |||^***         |  | ||   | ^*** || |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  ^***** |   | .. |  |        || ||        | |          |  |       |  |              |  ||  |       | |||  |          |  | ^*****    | || |              
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           |  |||||  |   | .. |  |        |^***        | |          |  |       |  |              |  ||  |       | |||  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..           ********  |   | .. |  |        |  |         | |          |  |       |  |              |  ||  |       | |||  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |||||  |   | .. |  |        ****         | |          |  |       |  |              |  ||  |       ****|  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  nest ..              *****  |   | .. |  |                     | |          |  |       |  |              |  ||  |       *** |  |          |  |  |        ******              
search RasMol script viewer Motif-ligand binding stats  niche ..                     |   | .. ****                     ***          ****       ****              ********           ****          *******                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     ***** ..                                                                                                                                        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAB12
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF417PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchQ6IQ22
JMol viewer RasMol script viewer  UNX 1406A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1405A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1404A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1403A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1402A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  UNX 1401A  ..                           ..                                                                                                                                        
JMol viewer RasMol script viewer  GDP 401A  ..             ** ****       ..                                                                                  ** **                          ***                    
JMol viewer RasMol script viewer  CA 501A  ..             || ||||       ..                                                                                  || ||                          |||     **             
JMol viewer RasMol script viewer  MG 402A  ..             || ||*|       ..                                                                                  || ||                          |||     ||             
sec str:  .....eeeeeeee.....hhhhhhhhhh.......eeeeeeeeee..eeeeeeeeee..hhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhh..hhhhhhhhhhh....eeee.......hhhhhhhhhhhhhhhh.
sequence :  ..PADFKLQVIIIGSRGVGKTSLMERFTD..STVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKM
seq num:  ..134       144       154    ..169       179       189       199       209       219       229       239       249       259       269       279       289       299   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  |||||| ||  | .. |  |        || ||        | |          | |||      | |**^*  |        |  ||  |       | |||| ||         |  | ||   | | || || |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |||||| ||  | .. |  |        || ||        | |          | ^**      | ^**||  |        |  ||  |       | |||^**|         |  | ||   | ^**| || |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |||||^***  | .. |  |        || ||        | |          |  |       | ^***^***        |  ||  |       | |||^***         |  | ||   | ^*** || |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  ^***** |   | .. |  |        || ||        | |          |  |       |  |              |  ||  |       | |||  |          |  | ^*****    | || |              
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           |  |||||  |   | .. |  |        |^***        | |          |  |       |  |              |  ||  |       | |||  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..           ********  |   | .. |  |        |  |         | |          |  |       |  |              |  ||  |       | |||  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |||||  |   | .. |  |        ****         | |          |  |       |  |              |  ||  |       ****|  |          |  |  |        | || |              
search RasMol script viewer Motif-ligand binding stats  nest ..              *****  |   | .. |  |                     | |          |  |       |  |              |  ||  |       *** |  |          |  |  |        ******              
search RasMol script viewer Motif-ligand binding stats  niche ..                     |   | .. ****                     ***          ****       ****              ********           ****          *******                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     ***** ..                                                                                                                                        

   New search    2il1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors