triangle PDBeMotif: 2ik8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Mon, Oct 2, 2006
Title crystal structure of the heterodimeric complex of human rgs1 activated gi alpha 1
Authors A.EDWARDS, A.P.TURNBULL, C.ARROWSMITH, D., E.PAPAGRIGORIOU, F., F.VON DELFT, J.DEBRECZENI, J.WEIGELT, M.SOUNDARARAJAN, M.SUNDSTROM, STRUCTURAL GENOMICS CONSORTIUM (SGC)
Method X-RAY DIFFRACTION (resolution: 2.71Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP   search ALF ALF binding statistics ALF   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
Chains B,D sequence:
SMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEV
NIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASAT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GUANINE NUCLEOTIDE-BINDING PROTEIN G(I), ALPHA-1
member of: CATH:search1.10.400.10/search3.40.50.300GENE3D:searchG3DSA_1.10.400.10/searchG3DSA_3.40.50.300PANTHER:searchPTHR10218/searchPTHR10218_SF173PFAM:searchPF00503PRINTS:searchGPROTEINA/searchGPROTEINAISMART:searchSM00275SUPERFAMILY:searchSSF47895/searchSSF52540UniProt:searchP63096
JMol viewer RasMol script viewer  SO4 357C  ..                                                             **                 ..                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  GDP 401A  ..           * ****                                            ||                 ..                                                        ****                                                                                          ** **                                                   ***                     
JMol viewer RasMol script viewer  ALF 355A  ..          ** |*||                                            ||                 ..                                                        |||* **                     **                                                                || ||                                                   |||                     
JMol viewer RasMol script viewer  SO4 360A  ..          || ||||                                            ||                 ..                                                        |||| ||                     ||        *                                                       || ||                                                   |||                     
JMol viewer RasMol script viewer  SO4 359A  ..   *      || ||||                                            ||                 ..                                                        |||| ||                 *   ||        |                                                       || ||                                                   |||                     
JMol viewer RasMol script viewer  SO4 358A  ..   |      || ||||                                            ||                 ..                                                        |||| ||                 |   ||        |                                                       || ||                   **                              |||                     
JMol viewer RasMol script viewer  SO4 357A  ..   |      || ||||                                            ||          *      ..                                                        |||| ||                 |   ||        |                                                       || ||                   ||                              |||                     
JMol viewer RasMol script viewer  MG 356A  ..   |      || ||*|                                            ||          |      ..                                                        |||| |*                 |   ||        |                                                       || ||                   ||                              |||                     
sec str:  ...eeeeeee.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh......hhhhhhhh......eeeeeee....eeeeeee..hhhhhhhhhhhh....eeeeeee.hhhh.ee..eeeeehhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhh...hhhhh........hhhhhhhhhhhhhhhh.........eeee....hhhhhhhhhhhhhhhhhhh..
sequence :  ..REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA..MTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
seq num:  ..32        42        52        62        72        82        92        102       ..119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        || |||||      |      ||  ||  |   |   |             | |    | |           ..           |  | | | ||^***|   ^***  |  |  |  |     |  ||  ||  | |    | |||||       | | |||    |  |           || ||    |  ||   || |    |  | ||  |       | |     |  | |  ||  | |  |  |        || || |||||       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        || |||||      |      ||  ||  |   |   |             | |    | |           ..           |  | | | || |  |         |  |  |  |     |  ||  ||  | |    | |||||       | | |||    |  |           || ||    |  ||   || |    |  | ||  |       | |     |  | |  ||  | |  |  |        || || **^*|       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        || |^**|      |      ||  ||  |   |   |             | |    ^**           ..           |  | | | || |  |         |  |  |  |     |  ||  ||  | |    | ^**||       | | ^**    |  |           || ||    |  ||   |^**    |  | ||  |       | |     |  | |  ||  | |  |  |        || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        || |||||      |      |^***|  |   |   |             | |                  ..           |  | | | || |  |         |  |  |  |     ^***|  ||  | |    | ^***|       | |  |     |  |           ^***|    |  ||   |       |  | ||  |       | |     |  | |  ||  | |  ^***        || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        || |||||      *******^    |  |   |   |             | |                  ..           |  | | | || |  |         |  |  |  |     |   |  ||  | |    |  |  |       | |  |     |  |            |  |    |  ||   |       |  | ||  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****||                  |  |   |   |             | |                  ..           |  | ^***** |  |         |  |  |  |     |   |  ||  | ^*****  |  |       ^*****     |  |            |  |    |  ||   |       |  | ||  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        ********                  |  |   |   |             | |                  ..           |  |   | |  |  |         |  |  |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  ||   |       |  | ||  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..         | |||||                  |  |   |   |             | |                  ..           |  |   | |  |  |         |  |  |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  ||   |       |  | ||  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |||||                  |  |   |   |             | |                  ..           |  |   | |  |  |         |  |  |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  ||   |       |  | ||  |       | |     |  | *****  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |||||                  |  |   |   |             | |                  ..           |  ***** |  |  |         |  |  |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  |*****       |  | ||  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |||||                  |  |   |   |             | |                  ..           |  |     |  |  |         |  |  |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  |            |  ***|  |       | |     |  | |  ||  | |              || ||  |  |       |  |               |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|||                  ****   |   |             | |                  ..           |  |     *******         ****  |  |     |   |  ||  |         |  |       | |        |  |            ****    |  |            |  |  ****       | |     |  | ****|  | |              ****|  |  |       |  |               **** 
search RasMol script viewer Motif-ligand binding stats  nest ..           *****                         |   |             ***                  ..           |  |                           |  |     |   |  ||  |         |  |       | |        |  |            |  |    |  |            |  |  |  |       ***     |  |     |  | |               |  |  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..           |                             |   |                                  ..           ****                           ****     |   ****|  |         ****       ***        ****            ****    ****            ****  ****               ****     ******               ****  ****       ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |                             |   |                                  ..                                                   *****   |  |                      |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..           |                             *****                                  ..                                                           |  |                      |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                                                                    ..                                                           *  *                      *                                                                                                                                                

chain B : REGULATOR OF G-PROTEIN SIGNALING 16
member of: CATH:search1.10.167.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchO15492
JMol viewer RasMol script viewer  SO4 302B  ..                                       ***                                                                              
JMol viewer RasMol script viewer  SO4 360A  ..                                       |||                                                                              
sec str:  ..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQA
seq num:  ..65        75        85        95        105       115       125       135       145       155       165       175       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||| |||        |  |||||           |  | | |                        |   |            |  |      ||  |   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||| ^**        |  |||||           |  | | |                        |   |            |  |      ||  |   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||| ||         |  |||||           |  | | |                        |   |            ^***      |^***   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| ||| ||         |  |||||           |  | | |                        |   |            |  |      ********^  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||| ||         |  |||||           |  | | |                        |   |            |  |                 |  |  *****   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| ||| ||         |  |||||           |  | | |                        *****            |  |                 |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |****|         ****||||           |  | | |                                         ****                 ****  ****    
search RasMol script viewer Motif-ligand binding stats  nest ..| | |  |             ****           |  | | |                                                              |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..| | ****                            ****** |                                                              ****          
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                      ***                                                                            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : GUANINE NUCLEOTIDE-BINDING PROTEIN G(I), ALPHA-1
member of: CATH:search1.10.400.10/search3.40.50.300GENE3D:searchG3DSA_1.10.400.10/searchG3DSA_3.40.50.300PANTHER:searchPTHR10218/searchPTHR10218_SF173PFAM:searchPF00503PRINTS:searchGPROTEINA/searchGPROTEINAISMART:searchSM00275SUPERFAMILY:searchSSF47895/searchSSF52540UniProt:searchP63096
JMol viewer RasMol script viewer  GDP 402C  ..          ******                                                               ..                               **                       ****                                                                                          ** **                                                   ***                     
JMol viewer RasMol script viewer  ALF 355C  ..         **||*||                                                               ..                               ||                       |||* **                     **                                                                || ||                                                   |||                     
JMol viewer RasMol script viewer  SO4 358C  ..         |||||||                                                               ..                               ||                       |||| ||                     ||                                                                || ||                                                   |||                     
JMol viewer RasMol script viewer  MG 356C  ..         |||||*|                                                               ..                               ||                       |||| |*                     ||                                                                || ||                                                   |||                     
sec str:  ...eeeeee.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.....hhhhhhh.......eeeeeee....eeeeeee..hhhhhhhhhhhh....eeeeeee.hhhhh........hhhhhhhhhhhhhhhh......eeeeeeehhhhhhhhh...hhhhh........hhhhhhhhhhhhhhh..........eeee....hhhhhhhhhhhhhhhhhhh..
sequence :  ..EVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA..MTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
seq num:  ..33        43        53        63        73        83        93        103      ..119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       || |||||      |      ||  ||      |   |             | |   |||||          ..           |  | |   ||^***|   ^***  |  |  |  |     |  ||  ||  | |    | | ||        | | |||     ||| |       | || ||    | ||     | |    |  |  |  |       | |     |  | |  ||  | |  |  |        || || |||||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       || |||||      |      ||  ||      |   |             | |   |||||          ..           |  | |   || |  |         |  |  |  |     |  ||  ||  | |    | | ||        | | |||     ||| |       | || ||    | ||     | |    |  |  |  |       | |     |  | |  ||  | |  |  |        || || **^*|       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || |^**|      |      ||  ||      |   |             | |   |^**|          ..           |  | |   || |  |         |  |  |  |     |  ||  ||  | |    | ^**|        | | ^**     ||| |       | || ||    | ||     ^**    |  |  |  |       | |     |  | |  ||  | |  |  |        || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || |||||      |      |^***|      |   |             | |   ||| |          ..           |  | |   || |  |         |  |  |  |     ^***|  ||  | |    | ^***        | |  ||     ||| |       | ^***|    | ||            |  |  |  |       | |     |  | |  ||  | |  ^***        || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       || |||||      *******^|   |      |   |             | |   ||| |          ..           |  | |   || |  |         |  |  |  |     |   |  ||  | |    |             | |  ||     ||| |       |  |  |    | ||            |  |  |  |       | |     |  | |  ||  | |              || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****||              |   |      |   |             | |   ||| |          ..           |  | ^***** |  |         |  |  |  |     |   |  ||  | ^*****             ^*****|     ||| |       |  |  |    | ||            |  |  |  |       | |     |  | |  ||  | |              || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..       ********              |   |      |   |             | |   ||| |          ..           |  |     |  |  |         |  |  |  |     |   |  ||  |                    | |  ||     ||| |       |  |  |    | ||            |  |  |  |       | |     |  | |  ||  | |              || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..        | |||||              |   |      |   |             | |   ||| |          ..           |  |     |  |  |         |  |  |  |     |   |  ||  |                    | |  ||     ||| |       |  |  |    | ||            |  |  |  |       | |     |  | |  ||  | |              || || || ||       |  |       |   ||  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |||||              |   |      |   |             | |   ||| |          ..           |  |     |  |  |         |  |  |  |     |   |  ||  |                    | *****     ||| |       |  |  |    | ||            |  |  |  |       | |     |  | *****  | |              || || *****       |  |       |   |*****   
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |||||              |   |      |   |             | |   *** |          ..           |  |     |  |  |         |  |  |  |     |   |  ||  |                    | |  |      ||| |       |  |  |    ***|            |  |  |  |       | |     |  | |  ||  | |              || || || ||       |  |       |   ||  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|||              |   |      |   |             | |    ****          ..           |  |     *******         ****  |  |     |   |  ||  |                    | ****      ||| |       ****  |    |  |            |  |  |  |       | |     |  | ******** |              ****| ****|       ****       |   |****    
search RasMol script viewer Motif-ligand binding stats  nest ..          *****              |   |      |   |             ***                  ..           |  |                           |  |     |   |  ||  |                    | |         ||| |          |  |    |  |            |  |  |  |       ***     |  |     |  | |               |  |  |  |       |  |       |   |        
search RasMol script viewer Motif-ligand binding stats  niche ..          |                  |   |      |   |                                  ..           ****                           ****     |   ****|  |                    ***         *****          ****    ****            ****  ****               ****     ******               ****  ****       ****       |   |        
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |                  *****      |   |                                  ..                                                   *****   |  |                      |                                                                                                                                   |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..          |                             *****                                  ..                                                           |  |                      |                                                                                                                                   *****        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..          *                                                                    ..                                                           *  *                      *                                                                                                                                                

chain D : REGULATOR OF G-PROTEIN SIGNALING 16
member of: CATH:search1.10.167.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchO15492
JMol viewer RasMol script viewer  SO4 303D  ..                                                 ***                                                                              
sec str:  ..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..FSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQA
seq num:  ..55        65        75        85        95        105       115       125       135       145       155       165       175       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..***    |  | | | |||         || ||||           |  | |                |  |   | ||   |          | || |      ||  |   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  | | | ^**         || ||||           |  | |                |  |   | ||   |          | || |      ||  |   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  | | | ||          || ||||           |  | |                |  |   | ||   |          | ^***      |^***   |  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       |  | | | ||          || ||||           |  | |                |  |   | ||   |          |  |        ********^  |  |  |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |  | | | ||          || ||||           |  | |                |  |   | ||   |          |  |                   |  |  *****   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       |  | | | ||          || ||||           |  | |                |  |   | |*****          |  |                   |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  | | | ||          |****||           |  | |                ****   | |               ****                   ****  ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  | | | ||          |  ||||           |  | |                       ***                                      |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..       |  | | | ||          |  ****           |  | |                                                                |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..       **** | ****          |    |            ******                                                                ****          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          | |   |           ******                                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..          | *****                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***                                                                                                                     

   New search    2ik8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors