triangle PDBeMotif: 2ihd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Tue, Sep 26, 2006
Title crystal structure of human regulator of g-protein signaling
Authors (SGC), A., A.P.TURNBULL, C.ARROWSMITH, C.BHATIA, C.GILEADI, D.A.DOYLE, E.PAPAGRIGORIOU, E.SALAH, E.UGOCHUKWU, F.VON DELFT, J.BRAY, J.ELKINS, J.WEIGELT, M.SUNDSTROM, N, O.GILEADI, STRUCTURAL GENOMICS CONS
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MHHHHHHSSGVDLGTENLYFQSMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRST
AKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALING 8
member of: CATH:search1.10.167.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF147PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchP57771
JMol viewer RasMol script viewer  CL 1A  ..                                        *                                                                *                     
sec str:  ..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..STEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLL
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*  |  |  ||   | |||        || |||||           |  | || ||         |  |  |      |   |  | |  |  | |  |       |  |      |  |  || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |  ||   | ^**        || |||||           |  | |^**|         |  |  |      |   |  ^**  |  | |  |       |  |      |  |  || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  |  ||   |  |         || |||||           |  | |   |         |  |  |      |   |    |  |  | ^***       ^***      |  |  || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  ||   |  |         || |||||           |  | |   |         |  |  |      |   |    |  |  | |                    |  |  || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  ||   |  |         |*****||           |  | |   |         |  |  |      |   |    |  |  | |                    |  |  || | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  ||   |  |         || |||||           |  | |   |         |  |  |      *****    |  |  | |                    |  |  || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|   |  |         *****|||           |  | |   |         |  |  |               ****  | |                    ****  **** 
search RasMol script viewer Motif-ligand binding stats  nest ..          |   |  |             ****           |  | |   |         |  |  |                     | |                    |  |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..          |   ****                            **** |   |         *******                     | |                    ****   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..          *****                                    *****                                     | |                       *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                             ***                               

   New search    2ihd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors