triangle PDBeMotif: 2ht8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.1.18
Classification hydrolase    | release date: Tue, Jul 25, 2006
Title n8 neuraminidase in complex with oseltamivir
Authors A.J.HAY, D.J.STEVENS, G.M.BL, J.J.SKEHEL, L.F.HAIRE, P.J.COLLINS, R.J.RUSSELL, S.J.GAMBLIN, Y.P.LIN
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search G39 G39 binding statistics G39
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
TYMNNTEAICDAKGFAPFSKDNGIRIGSRGHIFVIREPFVSCSPIECRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVE
VGQSPNVYQARFEAVAWSATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVVNSWAGDILRTQESSCTCIQGDCYWVM
TDGPANRQAQYRIYKANQGRIIGQTDISFNGGHIEECSCYPNDGKVECVCRDGWTGTNRPVLVISPDLSYRVGYLCAGIP
SDTPRGEDTQFTGSCTSPMGNQGYGVKGFGFRQGTDVWMGRTISRTSRSGFEILRIKNGWTQTSKEQIRKQVVVDNLNWS
GYSGSFTLPVELSGKDCLVPCFWVEMIRGKPEEKTIWTSSSSIVMCGVDYEVADWSWHDGAILPFDIDKM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NEURAMINIDASE
member of: CATH:search2.120.10.10GENE3D:searchG3DSA_2.120.10.10PFAM:searchPF00064SUPERFAMILY:searchSSF50939UniProt:searchQ07599
JMol viewer RasMol script viewer  G39 800A  ..                                   **                               **                                                                      * *                     *                             **              *                                                    *                       *                                 *                                                                 
sec str:  .................eeeee.hhhhhhh....eeeeeeeeee....eeeeeeeeeee..hhhhh...........eeeee.....hhhhheeee....eeeee....eeeeeee......eeeeee...eeeeee.......ee.....eee..eeeeeeee.......eeeeeee....eeeeeee..........eeee....eeee..........eeeee.....eeeee...................................eeee..eeeeee.......eeeeeeee..........eeeeeeeeeeeee...................eeeeeeeeeee........eeeeeeeee.....................
sequence :  ..TYMNNTEAICDAKGFAPFSKDNGIRIGSRGHIFVIREPFVSCSPIECRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVEVGQSPNVYQARFEAVAWSATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVVNSWAGDILRTQESSCTCIQGDCYWVMTDGPANRQAQYRIYKANQGRIIGQTDISFNGGHIEECSCYPNDGKVECVCRDGWTGTNRPVLVISPDLSYRVGYLCAGIPSDTPRGEDTQFTGSCTSPMGNQGYGVKGFGFRQGTDVWMGRTISRTSRSGFEILRIKNGWTQTSKEQIRKQVVVDNLNWSGYSGSFTLPVELSGKDCLVPCFWVEMIRGKPEEKTIWTSSSSIVMCGVDYEVADWSWHDGAILPFDI
seq num:  ..83        93        103       113       123       133       143       153       163       172       182       192       202       212       222       232       242       252       262       272       282       292       302       313       323       332       344       354       364       374       384       395       405       12        421       431       442       452       462    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ^***             ||||| || |            | ||       ||||  | | ^***|| | ||      |||   |                ||||      |  |         |    |            | |                                         |  |   |                   ||||       | | |           | |        |  |                | |     | | | ||  |     ||| |||||        |  ^***       |  || ||                               | |     |  | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |             ||||| || |            | ||       ||||  | | ||^**| | ||      |||   |                ||||      |  |         |    |            | |                                         |  |   |                   |^**       | ^**           ^**        |  |                | |     | | ^**|  |     ||| |^**|        |  |          |  |^**|                               | |     |  | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |             ||||| || |            ^***       ||||  | | ||^*** | ||      |||   |                ||||      ^***         |    |            | |                                         |  |   |                   | |        | |                        |  |                | |     | |    ^***     ||| |^***        |  |          |  |^***                               | |     ^*** |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |             ||^***** |            | |        |^***** | ||| || | ||      |^*****                ||||                   ^*****            | |                                         |  |   |                   | |        | |                        |  |                | |     | |             ||| | |          |  |          |  || |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | |             ||||| || |            | |        | ||  | | ||| || | ||      | |                    ^***                                     | |                                         |  |   |                   | |        | |                        |  |                | |     | |             ||| | |          |  |          |  || |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |             ||||| || |            | |        | ||  | | ||| || | ||      | |                    ||||                                     | |                                         |  |   |                   | |        | |                        |  |                | |     | |             ||| | |          |  |          ***** |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |             ***|| || |            | |        | ||  *** ||| || | ||      | |                    ***|                                     | |                                         |  |   |                   | |        ***                        |  |                | |     | |             ||| | |          |  |          |  || |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |             ||||**** |            | |        | ||  |   |****| | ||      | |                    ||||                                     | |                                         |  |   |                   | |        | |                        |  |                | |     | |             ||| | |          ****          ****| |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |             ||||  |  |            | |        | ||  |   ***  | | ||      ***                    ||||                                     | |                                         |  |   |                   | |        | |                        |  |                | |     | |             ||| | |          |  |              | |                                | |        | |      
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ****  |  |            | |        ***|  |        | | ||                             ****                                     ***                                         |  |   |                   | |        ***                        |  |                | |     | |             *** | |          |  |              | |                                | |        ***      
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                   ****            | |           ****        | ****                                                                                                                  ****   |                   ***                                   ****                ***     ***              ******          ****              | |                                ***                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          ***                       | ***                                                                                                                          |                                                                                                                                        ***                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                    *                                                                                                                              *                                                                                                                                                                                               

   New search    2ht8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors