triangle PDBeMotif: 2hp4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Mon, Jul 17, 2006
Title computational design and crystal structure of an enhanced af mutant human cd8-alpha-alpha co-receptor
Authors B.K.JAKOBSEN, D.K.COLE, G.F., J.M.BOULTER, M.GLICK, P.J.RIZKALLAH
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKAAEGLDTQRFSGKRLGDTFVLT
LSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10441/searchPTHR10441_SF1PFAM:searchPF07686PROSITE PROFILES:searchPS50835, SMART:searchSM00406SUPERFAMILY:searchSSF48726UniProt:searchP01732
JMol viewer RasMol script viewer  SO4 303B  ..                                                                                                                  
JMol viewer RasMol script viewer  GOL 403A  ..                                    *         * *                  *                   *   *                      
JMol viewer RasMol script viewer  GOL 401A  ..*                                   |         | |                  |                   |   |             *        
JMol viewer RasMol script viewer  SO4 305A  ..|                     *             |         | |                  |     ***           |   |             |        
JMol viewer RasMol script viewer  SO4 304A  ..|                     |             |         | |   ***            |     |||           |   |             |        
JMol viewer RasMol script viewer  SO4 302A  ..|                   * |             |         | |   |||            |     |||           |   |             |        
JMol viewer RasMol script viewer  SO4 301A  ..|  *                | |             |         | |   |||            |     |||           |   |             |        
sec str:  ....eeee...........eeeeeee........eeeeeee.......eeeeee.....ee........eeeeee..eeeeee...hhhh.eeeeeeeee..eeee...eee....
sequence :  ..SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || ||  |  |       | |                                 |  ||^**|^**|       |  | || ||  |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***|  |  |       | |                                 |  |||| ||  |       ^*** || ||  |                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |  |  |       | |                                 |  |||| ||  |            *******^                      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |  |  |       | |                                 |  |||| |^***            || ||                         
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |  |  |       | |                                 |  |*** |                || ||                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |  |  |       | |                                 |  | |  |                ****|                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****       ***                                 **** ****                 ****                         

chain B : T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10441/searchPTHR10441_SF1PFAM:searchPF07686PROSITE PROFILES:searchPS50835, SMART:searchSM00406SUPERFAMILY:searchSSF48726UniProt:searchP01732
JMol viewer RasMol script viewer  GOL 404B  ..                                    *           *                  *                   *   *                      
JMol viewer RasMol script viewer  GOL 402B  ..*                                   |           |                  |                   |   |             *        
JMol viewer RasMol script viewer  SO4 303B  ..|                                   |           |   ***            |                   |   |             |        
JMol viewer RasMol script viewer  SO4 304A  ..|                                   |           |   |||            |                   |   |             |        
sec str:  ....eeee...........eeeeeee........eeeeeee.......eeeeee.....ee........eeeeee..eeeeee...hhhh.eeeeeeeee..eeee...eee....
sequence :  ..SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || ||  |  |       | |                                 |  | ^**|^**|       |  | || ||  |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***|  |  |       | |                                 |  | |  ||  |       ^*** || ||  |                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |  |  |       | |                                 |  | |  ||  |            *******^                      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |  |  |       | |                                 |  | |  |^***            || ||                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |  |  |       | |                                 |  | |  |                ****|                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****       ***                                 **** ****                 ****                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10441/searchPTHR10441_SF1PFAM:searchPF07686PROSITE PROFILES:searchPS50835, SMART:searchSM00406SUPERFAMILY:searchSSF48726UniProt:searchP01732
JMol viewer RasMol script viewer  GOL 403A  ..                                    *         * *                  *                   *   *                      
JMol viewer RasMol script viewer  GOL 401A  ..*                                   |         | |                  |                   |   |             *        
JMol viewer RasMol script viewer  SO4 305A  ..|                     *             |         | |                  |     ***           |   |             |        
JMol viewer RasMol script viewer  SO4 304A  ..|                     |             |         | |   ***            |     |||           |   |             |        
JMol viewer RasMol script viewer  SO4 302A  ..|     *  *          * |             |         | |   |||            |     |||           |   |             |        
JMol viewer RasMol script viewer  SO4 301A  ..|  *  |  |          | |             |         | |   |||            |     |||           |   |             |        
sec str:  ....eeee...........eeeeeee........eeeeeee.......eeeeee.....ee........eeeeee..eeeeee...hhhh.eeeeeeeee..eeee...eee....
sequence :  ..SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || ||  |  |       | |                                 |  ||^**|^**|       |  | || ||  |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***|  |  |       | |                                 |  |||| ||  |       ^*** || ||  |                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |  |  |       | |                                 |  |||| ||  |            *******^                      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |  |  |       | |                                 |  |||| |^***            || ||                         
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |  |  |       | |                                 |  |*** |                || ||                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |  |  |       | |                                 |  | |  |                ****|                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****       ***                                 **** ****                 ****                         

chain B : T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10441/searchPTHR10441_SF1PFAM:searchPF07686PROSITE PROFILES:searchPS50835, SMART:searchSM00406SUPERFAMILY:searchSSF48726UniProt:searchP01732
JMol viewer RasMol script viewer  GOL 404B  ..                                    *           *                  *                   *   *                      
JMol viewer RasMol script viewer  GOL 402B  ..*                                   |           |                  |                   |   |             *        
JMol viewer RasMol script viewer  SO4 303B  ..|                                   |           |   ***            |                   |   |             |        
JMol viewer RasMol script viewer  SO4 301A  ..|     *  *                          |           |   |||            |                   |   |             |        
sec str:  ....eeee...........eeeeeee........eeeeeee.......eeeeee.....ee........eeeeee..eeeeee...hhhh.eeeeeeeee..eeee...eee....
sequence :  ..SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || ||  |  |       | |                                 |  | ^**|^**|       |  | || ||  |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***|  |  |       | |                                 |  | |  ||  |       ^*** || ||  |                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |  |  |       | |                                 |  | |  ||  |            *******^                      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |  |  |       | |                                 |  | |  |^***            || ||                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |  |  |       | |                                 |  | |  |                ****|                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****       ***                                 **** ****                 ****                         

   New search    2hp4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors