triangle PDBeMotif: 2hct  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.5
Classification hydrolase    | release date: Sun, Jun 18, 2006
Title acidic residues at the active sites of cd38 and adp-ribosyl determine naapd synthesis and hydrolysis activities
Authors H.C.LEE, I.A.KRIKSUNOV, Q.HAO, Q.LIU, R.GRAEFF
Method X-RAY DIFFRACTION (resolution: 1.95Å)
PDBe Citation   
Small molecules:    search NMN NMN binding statistics NMN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVGVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  NMN 301A  ..                                                                                *** *               **        **                                *                              ***                                                                          
sec str:  ...............hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhh.eeee.hhhhhhhhhhhh....hhhhhhhhhhhh...........................hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh......
sequence :  ..RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVGVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
seq num:  ..45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  ^**||  |    |   |  |  |  || ||  |   | || ||| ||||||||   |  |    |  |   | |               |||||   | || |    |  ^** | ||  |           |   | ^** |  |        |  | | || ||   | ||  | |  |                 |  | ^**| |  |^**||  ^**                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |   | ||  |    |   |  |  |  || |^***   | || ||| ||^***||   |  |    |  |   | |               ^***|   | || |    |  | | | |^***           |   |     |  |        |  | | || ||   | ||  | |  |                 |  | ^*** |  || |||                         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |   | ||  |    |   |  |  |  || |       ^*****|| ||||||||   |  |    |  |   | |               |||||   | || |    |  | | | |               |   |     |  |        |  | | || ||   | ||  | |  |                 |  |      |  || |||                         
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |   | ||  |    |   |  |  |  |***       | || ||| ||||||||   |  |    |  |   | |               |||||   | || |    |  | | ***               |   |     |  |        |  | | |***|   | ||  | |  |                 |  |      |  || |||                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |   ****  |    |   |  |  |  |          | || |****|******   |  |    |  |   | |               ****|   | ****    |  | |                   |   |     |  |        |  | | ||  |   | ||  | |  |                 |  |      |  *****|                         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |     |   |    |   |  |  |  |          | || | |  || | |    |  |    |  |   ***               ||| |   | || |    |  | |                   |   |     |  |        |  | | ||  |   | ||  | |  |                 |  |      |  || | |                         
search RasMol script viewer Motif-ligand binding stats  nest ..     | |     |   |    |   |  |  |  |          | || | |  || | |    |  |    |  |                     ||| |   | || |    |  | |                   |   |     |  |        |  | | ||  |   | ||  | |  |                 |  |      |  || ***                         
search RasMol script viewer Motif-ligand binding stats  niche ..     ***     |   |    |   ****  ****          ****** ****| | |    ****    ****                     |****   ******    ******                   |   |     ****        **** *******   | |**** ****                 ****      |  ||   |                         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..             |   |    |   |                              | | |                                     | | |                                      |   |                            |   | |                                    |  ******                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..             |   |    |   |                              *****                                     *****                                      |   |                            ***** |                                    |   |                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..             *****    *****                              | |                                       | |                                        *****                                  |                                    *****                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                         ***                                       ***                                                                               |                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                     *                                                                               *                                                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  NMN 302B  ..                                                                                *** *               **        **                                *                              ***                                                                          
sec str:  .........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh.........eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhh.........eeeeeeeee........hhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh......
sequence :  ..RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVGVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
seq num:  ..45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  ^**|   |    |   |  |  |  |   |  | | |||| | |  ||| ||   ||  |    |  |                |  | |||||   | || |       ^** | ||  |   |             ^** |  |                | |||  | ||  ||| ||            | |  |  | ^**| |   ^** |  ^**          |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |     |   |    |   |  |  |  |   ^*** | |||| | |  |^***|   ||  |    |  |                |  | ^***|   | || |       | | | |^***   |                 |  |                | |||  | ||  ||| ||            | |  |  | ^*** |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |     |   |    |   |  |  |  |        | ^***** |  | |  |   ||  |    |  |                |  |  || |   | || |       | | | ||  |   |                 |  |                | |||  | ||  ||| ||            | |  |  | |    |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |     |   |    |   |  |  |  |        | |||| | |  | |  |   ||  |    |  |                |  |  || |   | || |       | | | ||  |   |                 |  |                | |||  | ||  |*****            | |  |  | |    |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | |     |   |    |   |  |  |  |        | |||| | |  | |  |   ||  |    |  |                |  |  || |   | || |       | | | ||  *****                 |  |                *****  | ||  ||| ||            | |  |  | |    |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |     |   |    |   |  |  |  |        | |||| | |  | |  |   ||  |    |  |                |  |  || |   | || |       | | ***|                        |  |                ***|   | ||  ||| ||            | |  |  ***    |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |     |   |    |   |  |  |  |        ****|| | |  | ****   ||  |    |  |                ****  || |   | ****       | | |  |                        |  |                ****   | ||  |****|            | |  |  |      |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |     |   |    |   |  |  |  |          | || | |  |        ||  |    |  |                |  |  || |   | || |       | | |  |                        |  |                |  |   | ||  | |  |            ***  |  |      |   | | |               |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..     | |     |   |    |   |  |  |  |          | || | |  |        ||  |    |  |                |  |  || |   | || |       | | |  |                        |  |                |  |   | ||  | |  |                 |  |      |   | ***               |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..     ***     |   |    |   ****  ****          ****** ****        |****    ****                ****  ****   ******       *** ****                        ****                ****   | |**** ****                 ****      |   |                   ****      
search RasMol script viewer Motif-ligand binding stats  stmotif ..             |   |    |   |                                      |   |                               | *****                                                                   |   | |                                    |   |                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..             *****    *****                                      *****                               |                                                                         ***** |                                    *****                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                     *                                                                               *                                                                      

   New search    2hct:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors