triangle PDBeMotif: 2haz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell adhesion    | release date: Tue, Jun 13, 2006
Title crystal structure of the first fibronectin domain of human ncam1
Authors A.LAVIE, N.SEKULIC
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYA
VRLAALNGKGLGEISAASEFKTQPV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NEURAL CELL ADHESION MOLECULE 1
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF34PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF48726/searchSSF49265UniProt:searchP13591
JMol viewer RasMol script viewer  NA 101A  ..           *             *                                                                              
sec str:  ...........eeeeeee....eeeeee...........eeeeeeee......eeeeeehhhhhhhheeee.......eeeeeeeeee..ee......eeee....
sequence :  ..SHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPV
seq num:  ..486       496       506       516       526       536       546       556       566       576       586 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***            |  |          | |           |  | |             | |  |  ||  |                            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  |          | |           **** |             | |  |  ||  |                            
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |          ***           |  | |             ***  |  ||  |                            
search RasMol script viewer Motif-ligand binding stats  niche ..                ****          | |           ******                  ********                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                       

   New search    2haz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors