triangle PDBeMotif: 2ha0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Mon, Jun 12, 2006
Title crystal structure of mouse acetylcholinesterase complexed wi ketoamyltrimethylammonium
Authors E.KIM, G.SULZENBACHER, P.MARCHOT, P.TAYLOR, Y.BOURNE, Z.RADIC
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search FUC FUC binding statistics FUC   search CHH CHH binding statistics CHH   search IOD IOD binding statistics IOD   search P6G P6G binding statistics P6G   search NWA NWA binding statistics NWA
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
JMol viewer RasMol script viewer  P6G 901A  ..                                                                                                                                                                                                                                                                ..P6G ..                                                                                                                   **                                                                                                                                                 *       *        
JMol viewer RasMol script viewer  CHH 1602A  ..                                                                     * *                                                 *                                                                                                                                      ..CHH ..                     *                                                      *                                      ||                                                                                                                                                 |       |        
JMol viewer RasMol script viewer  NWA 601A  ..                                                                     | |           *                                 *** |                                                                              **                                                      ..NWA ..                     |          *                                           |                                      ||                                                                 *                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1111A  ..                                                                     | |           |                                 ||| |                                                                              ||                                                      ..IOD ..                     |          |                                           |                                      ||                                                   *          *  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1110A  ..                                                                     | |           |                                 ||| |                                                                              ||                                                      ..IOD ..                     |          |                                           |        ****                          ||                                                   |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1108A  ..                    *   **                                           | |           |                                 ||| |                                                                              ||                                                      ..IOD ..                     |          |                                           |        ||||                          ||                                                   |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1106A  ..                    |   ||                                           | |           |                                 ||| |                                                                              ||                                                      ..IOD ..                     |       ** |                                        *  *        ||||                          ||                                                   |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1104A  ..                    |   ||                                           | |           |                                 ||| |                                                                              ||                            **                        ..IOD ..                     |       || |                                        |  |        ||||                          ||                            *                      |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1103A  ..                    |   ||                                           | |           |                                 ||| |                                     *                                        ||                            ||      *   *             ..IOD ..                     |       || |                                        |  |        ||||                          ||                            |                      |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  IOD 1101A  ..                    |   ||                                           | |           |                                 ||| |                                     |                                        ||                            ||      |   |             ..IOD ..                     |   ** *||*|                                        |  |        ||||               *          ||                            |                      |          |  |                                                                               |       |        
JMol viewer RasMol script viewer  NAG 701A  ..                    |   ||                                           | |           |                                 ||| |                                     |                                        ||                            ||      |   |             ..NAG ..                     |   || |||||                                        |  |        ||||               |          ||                            |                      |          |  |              * *                                                              |       |        
JMol viewer RasMol script viewer  FUC 545A  ..                    |   ||                                           | |           |                                 ||| |                                     |                                        ||                            ||      |   |             ..FUC ..                     |   || |||||                                        |  |       **|||               |          ||                            |                      |          |  |              | |                                                              |       |        
JMol viewer RasMol script viewer  NAG 544A  ..                    |   ||                                           | |           |                                 ||| |                                     |                                        ||                            ||      |   |             ..NAG ..                     |   || |||||                                        |  |     * |*|||               |          ||                            |                      |          |  |              | |                                                              |       |        
sec str:  ....hhh.eeee..eeee.eeeee..eeeeeeeeee.....hhhhh............eee......ee..........hhhhhh......ee....eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee...........hhhhhhhhhhhhhhhh...... ..hhhhhhhhhh..hhhhhhhhhhhhh.....................hhhhhhhhh.....eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....................eeeee.....eeee..hhhhhhhhhhhhhhhhhhh
sequence :  ..REDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCP... ..NDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253   ... ..265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||| |  |  |    |   | ||   || ||   |   |||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |      |  | || ||   | ||| ..PS00001..^***    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || |^***        |    |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  |^*** ||      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  ||| |  |  |    |   | ||   || ||   |   |||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |      |  | |**^*   | ||| ..PS00004..   |    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |        |    |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | ||  ||      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||| |  |  |    |   | ||   || ||   |   |^** |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |      |  | |   |   | ||| ..PS00005..   |    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |        |    |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | ||  ||      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||| |  |  |    |   | ||   || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |      ^*** |   |   | ||| ..PS00006..   |    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |        |    |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | |^***|      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  ||| |  |  |    |   | ||   || ||   |   | || |         |    |             |  |   |  |  ********^     |                |||||||  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |           |   |   | ||| ..PS00007..   |    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |        |    |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||| |  |  ^*****   | ^*****| ^*****   | || |         ^*****             |  |   |  |     |||| |     |                ^*****|  ||  | |     | |           |  | |  |     | |              || ||||  |      |||  |   |  ||  |           | |           |   |   | |^**..PS00008..****    |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |        ^*****  |        ||  |   |  |   |                          | |      | | |  | | |  ^*****|    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..  ||| |  |  |        |  |    |  |       | || |                            |  |   |  |     |||| |     |                ||||| |  ||  | |     | |           |  | |  |     | |              || *************^**  |   |  ||  |           | |           |   |   | ||| ..PS00122..        |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |             |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..  ||| |  |  |        |  |    |  |       | || |                            |  |   |  |     |**^********                ||||| |  ||  | |     | |           |  | |  |     | |              || ||||  |      ||   |   |  ||  |           | |           |   |   | ||| ..PS00941..        |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |             |  |        ||  |   |  |   |                          | |      | | |  | | |  | |||||    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ||| |  |  |        |  |    |  |       | || |                            |  |   |  |     | || |                      ||||| |  ||  | |     | |           |  | |  |     | |              || ||||  |      ||   |   |  ||  |           | |           |   |   | ||| ..asxmotif..        |  |         |  |   |  |       |||||  |  ||| ||||| |         |        |  || | | |             |  |        ||  |   |  *****                          | |      | | |  | | |  | |||||    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  asxturn ..  *** |  |  |        |  |    |  |       | || |                            |  |   |  |     | || |                      ||||| |  ||  ***     | |           |  | |  |     | |              || ||||  |      ||   |   |  ||  |           | |           |   |   | ||| ..asxturn..        |  |         |  |   |  |       ***||  |  ||| ||*** |         |        |  || | | |             |  |        ||  |   |  |                              | |      | | |  | | |  | |||||    |||  |  | ||   |      |   |    | | |   |  |         | |    ***        | |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  ****        ****    |  |       | || |                            ****   |  |     | || |                      ****| |  ||  |       | |           |  | ****     | |              *****|****      ||   |   |  |****           | |           |   |   ****| ..betaturn..        |  |         |  |   |  |       |||||  |  ||| || |  |         |        ****| | | |             |  |        ||  |   |  |                              | |      | | |  | | **** ****|    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                      |  |       | || |                            |  |   |  |     | |***                      ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |               | |           |   |     | | ..gammaturn..        |  |         |  |   |  |       |||||  |  ||| || |  |         |        |  || | | |             |  |        ||  |   |  |                              | |      | | |  | |       || |    |||  |  | ||   |      |   |    | | |   |  |         | |    | |        | |                
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |               | |           |   |     *** ..nest..        |  |         |  |   |  |       ****|  |  ||| || |  |         |        |  || | ***             |  |        ||  |   |  |                              ***      | | |  | |       |***    ***  |  ***|   |      |   |    *** |   |  |         ***    | |        ***                
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                      ****       ******                            ****   ****     | |                         ||    ********                     **** ****                                      ||   |   ****               ***           |   |         ..niche..        ****         ****   ****         ***  |  ||**** ****         |        ****| |                 ****        |****   ****                                       *** ******       |        |****     |   |      |   |      ***   ****                ***                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                          | |                         ||                                                                                ||   |                                    |   |         ..stmotif..                                              *****  |               |            | |                             |   |                                                               |        |         *****      |   |                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                          | |                         ||                                                                                |*****                                    *****         ..ststaple..                                                 *****               |            | |                             *****                                                               |        |                    *****                                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                          ***                         ||                                                                                ||                                                      ..stturn..                                                                     |            ***                                                                                                 |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                      **                                                                                **                                                      ..REP00000..                                                                     *                                                                                                                *        *                                                                                       

chain B : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
JMol viewer RasMol script viewer  CHH 2602B  ..                                                                    *                                                   *                                                                                                                                      ..CHH ..                       *                                                      *                                                                                                                                                                                                          
JMol viewer RasMol script viewer  NWA 601B  ..                                                                    |             *                                  ** |                                                                             ***                                                      ..NWA ..                       |        * *                                           |                                                                                                         *                                                                                                
JMol viewer RasMol script viewer  IOD 1114B  ..                                                                    |             |                                  || |                                                                             |||                                                      ..IOD ..                       |       ** |                                        *  |                                                                                                         |                                                                                                
JMol viewer RasMol script viewer  IOD 1113B  ..                                                                    |             |                                  || |                                                                             |||                                                      ..IOD ..                       |       || |                                        |  |        ****                                                                                             |                                                                                                
JMol viewer RasMol script viewer  IOD 1112B  ..                                                                    |             |                                  || |                                                                             |||                                    **  *             ..IOD ..                       |       || |                                        |  |        ||||                                                                                             |                                                                                                
JMol viewer RasMol script viewer  IOD 1109B  ..                                                 *  *   *           |             |                                  || |                                                                             |||                                    ||  |             ..IOD ..                       |       || |                                        |  |        ||||                                                                                             |                                                                                                
JMol viewer RasMol script viewer  IOD 1107B  ..                   *   **                        |  |   |           |             |                                  || |                                                                             |||                                    ||  |             ..IOD ..                       |       || |                                        |  |        ||||                                                                                             |                                                                                                
JMol viewer RasMol script viewer  IOD 1105B  ..                   |   ||                        |  |   |           |             |                                  || |                                                                             |||                                    ||  |             ..IOD ..                       |       || |                                        |  |        ||||                                                                               *          ** |                                                                                                
JMol viewer RasMol script viewer  IOD 1102B  ..                   |   ||                        |  |   |           |             |                                  || |                                                                             |||                                    ||  |             ..IOD ..                       |  *** *||*|                                        |  |        ||||               *                                                               |          || |                                                                                                
JMol viewer RasMol script viewer  NAG 1601B  ..                   |   ||                        |  |   |           |             |                                  || |                                                                             |||                                    ||  |             ..NAG ..                       |  ||| |||||                                        |  |     *  *|||               |                                                               |          || |                                                                                                
JMol viewer RasMol script viewer  P6G 901A  ..                   |   ||                        |  |   |           |             |                                  || |                                                                             |||                                    ||  |             ..P6G ..                       |  ||| |||||                                        |  |     |  ||||               |       *  **                                                   |          || |                                                                               *   *   *        
sec str:  ...hhh.eeee..eeee.eeeee..eeeeeeeeee.....hhhhh............eee......ee..........hhhhhh......ee....eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee...........hhhhhhhhhhhhhhhhh..... ....hhhhhhhhhhh.hhhhhhhhhhhhh.....................hhhhhhhhh.....eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....................eeeee.....eeee..hhhhhhhhhhhhhhhhhhh
sequence :  ..EDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCP... ..GGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254  ... ..263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||     |    |   | ||   || ||   |   |||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  | |  |  | ||     ||| ..PS00001..| ^***    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |^***        |    |  |        ||  || ||  |                              | |      | | |  | |    | |||||    |||  |  |^*** |       |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || ||     |    |   | ||   || ||   |   |||| |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  | |  |  **^*     ||| ..PS00004..| | ||    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||        |    |  |        ||  || ||  |                              | |      | | |  | |    | |||||    |||  |  | ||  |       |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||     |    |   | ||   || ||   |   |^** |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  | |  |           ||| ..PS00005..| | ||    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||        |    |  |        ||  || ||  |                              | |      | | |  | |    | |||||    |||  |  | ||  |       |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||     |    |   | ||   || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  | ^***           ||| ..PS00006..| | ||    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||        |    |  |        ||  || ||  |                              | |      | | |  | |    | |||||    |||  |  | |^***       |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||     |    |   | ||   || ||   |   | || |         |    |             |  |   |  |  ********^     |                |||||||  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  |                ||| ..PS00007..| | ||    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||        |    |  |        ||  || ||  |                              | |      | | |  | |    | |||||    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||     ^*****   | ^*****| ^*****   | || |         ^*****             |  |   |  |     |||| |     |                ^*****|  ||  |       | |           |  | |  |     | |              || |||          |||  |   |  ||  |  |        | | |  |                |^**..PS00008..^*****    |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||        ^*****  |        ||  || ||  |                              | |      | | |  | |    ^*****|    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. || ||              |  |    |  |       | || |                            |  |   |  |     |||| |     |                ||||| |  ||  |       | |           |  | |  |     | |              || *************^**  |   |  ||  |  |        | | |  |                | | ..PS00122..  | |     |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||             |  |        ||  || ||  |                              | |      | | |  | |      |||||    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. || ||              |  |    |  |       | || |                            |  |   |  |     |**^********                ||||| |  ||  |       | |           |  | |  |     | |              || |||          ||   |   |  ||  |  |        | | |  |                | | ..PS00941..  | |     |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||             |  |        ||  || ||  |                              | |      | | |  | |      |||||    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||              |  |    |  |       | || |                            |  |   |  |     | || |                      ||||| |  ||  |       | |           |  | |  |     | |              || |||          ||   |   |  ||  |  |        | | |  |                | | ..asxturn..  ***     |  |         |  |   |  |       ***|   |  ||| || |  |         |        |  || |||||             |  |        ||  |***|  |                              | |      | | |  | |      |||||    |||  |  | |           |   |    | | ||  |            | |    ***        | |           |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|              ****    |  |       | || |                            ****   ****     | || |                      ****| |  ||  |       | |           |  | ****     | |              *****|          ||   |   |  |****  |        | | |  |                | | ..betaturn..          |  |         |  |   |  |       ||||   |  ||| || |  |         |        ****| |||||             |  |        ||  |   |  |                              | |      | | |  | |      ****|    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |                      |  |       | || |                            |  |   |  |     | |***                      ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |        | | |  |                | | ..gammaturn..          |  |         |  |   |  |       ||||   |  ||| || |  |         |        |  || |||||             |  |        ||  |   |  |                              | |      | | |  | |       || |    |||  |  | |           |   |    | | ||  |            | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |        | | |  |                *** ..nest..          |  |         |  |   |  |       ****   |  ||| || |  |         |        |  || ||***             |  |        ||  |   |  |                              ***      | | |  | |       |***    ***  |  ***           |   |    *** ||  |            ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                      ****       ******                            ****   ****     | |                         ||    ********                     **** ****                                      ||   |   ****   ****        *** ****                    ..niche..          ****         ****   ****              |  ||**** ****         |        ******** |              ****        |****   ****                                       *** ******       |        |****                |   |      *******                   ***                      |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                         | |                         ||                                                                                ||   |                                                  ..stmotif..                                                *****  |               |            | |  |                          |   |                                                               |        |                    |   |                                                         |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                         | |                         ||                                                                                |*****                                                  ..ststaple..                                                   *****               |            ******                          *****                                                               |        |                    *****                                                         *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                         ***                         ||                                                                                ||                                                      ..stturn..                                                                       |            ***                                                                                                 |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     **                                                                                **                                                      ..REP00000..                                                                       *                                                                                                                *        *                                                                                       

   New search    2ha0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors