triangle PDBeMotif: 2h03  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.48
Classification hydrolase    | release date: Sat, May 13, 2006
Title structural studies of protein tyrosine phosphatase beta cata domain in complex with inhibitors
Authors A.G.EVDOKIMOV, C.M.CLARK, J.L.GRAY, K.D.AMARASINGHE, K.G.PE, M.B.MAIER, M.E.POKROSS, M.MEKEL, R.L.WALTER, R.NICHOLS
Method X-RAY DIFFRACTION (resolution: 1.65Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search 3UN 3UN binding statistics 3UN   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN TYROSINE PHOSPHATASE, RECEPTOR TYPE, B,
member of: CATH:search3.90.190.10GENE3D:searchG3DSA_3.90.190.10PANTHER:searchPTHR19134/searchPTHR19134_SF219PFAM:searchPF00102PRINTS:searchPRTYPHPHTASEPROSITE PATTERNS:searchPS00383, PROSITE PROFILES:searchPS50055/searchPS50056, SMART:searchSM00194SUPERFAMILY:searchSSF52799UniProt:searchP23467
JMol viewer RasMol script viewer  3UN 401A  ..                                                       ***                                                                      *                                                          **                                *** ***                                  *  *                      
JMol viewer RasMol script viewer  CL 305A  ..                                                       |||                     * *    **                                        |                                                          ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  MG 304A  ..                                                       |||                     | |    ||                                        |                                                          ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  MG 303A  ..                                                       |||                     | |    ||                                        |                                                          ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  CL 302A  ..                                                       |||                     | |****||                                        |                                                          ||                                ||| |||                                  |  |                      
sec str:  .......ee..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh...........eee......eeeeeee........eeee...hhhhhhhhhhhhhhh...eeee....ee..ee............eee..eeeeeeeeee...eeeeeeeeee..eeeeeeeeeeeee..........hhhhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
seq num:  ..1678      1688      1698      1708      1718      1728      1738      1748      1763      1773      1783      1793      1803      1813      1823      1833      1843      1853      1863      1873      1883      1893      1903      1913      1923      1933      1943      1953      1963    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||   |  |      |  |  ||| |   | || || ^***|| ||  || || |  |   |  |      | | ^***       | |      |  |  |       | |          |  |         | |           ||   |  || ||                       |  |  | |        | || |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*^*   |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |  |       | |          |  |         | |           ||   |  || ||                       |  |  | |        | || |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |  |       | |          |  |         | |           ||   |  |^**|                       |  |  | |        ^**| |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  ^***       | |          |  |         | |           ||   |  |^***                       |  |  | |        ^*** |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |      *******^| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  | |             |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  ^*****             |  | ^*****| | |^*****  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHATASE_1 ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  |               |  |       **^********  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |      |  |  | | |   | || || ||  || |***** || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  |               |  |           ||||     ||      || ||           *****  || |   |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         ***           ||   |  |                           |  |  |               |  |           ||||     ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           **   |  |                           |  |  |               |  |           ||||     ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****      |  |  | | |   **** || ||  ***********| |  |   |  |      | |            | |      ****          | |          ****         | |                |  |                           ****  |               ****           ||||     ||      ****|           ****|  || |   |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |  *** |     |  |***|   |  |   |  | |  |   |  |      | |            ***                    ***             |         | |                |  |                                 |                              ****     ||       |  |               |  |***   |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****  |   |     ********   ****   **** ****   ****      ***                                                   |         ***                ****                                 |                                ||     ||       ****               ****  |   |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                      |   |                                                                                                   |                                                                 |                                ||     ||                                *****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      *****                                                                                                   |                                                                 |                                ||     ||                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                 *                                **     **                                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN TYROSINE PHOSPHATASE, RECEPTOR TYPE, B,
member of: CATH:search3.90.190.10GENE3D:searchG3DSA_3.90.190.10PANTHER:searchPTHR19134/searchPTHR19134_SF219PFAM:searchPF00102PRINTS:searchPRTYPHPHTASEPROSITE PATTERNS:searchPS00383, PROSITE PROFILES:searchPS50055/searchPS50056, SMART:searchSM00194SUPERFAMILY:searchSSF52799UniProt:searchP23467
JMol viewer RasMol script viewer  3UN 401A  ..                                                       ***                                                                      *                                                          **                                *** ***                                  *  *                      
JMol viewer RasMol script viewer  CL 305A  ..                                                       |||                     * *    **                                        |                                                          ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  MG 304A  ..                                                       |||                     | |    ||                                        |               *                       *                  ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  MG 303A  ..                                                       |||                     | |    ||                                        |               |                       |                  ||                                ||| |||                                  |  |                      
JMol viewer RasMol script viewer  CL 302A  ..                                                       |||                     | |****||                                        |               |                       |                  ||                                ||| |||                                  |  |                      
sec str:  .......ee..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh...........eee......eeeeeee........eeee...hhhhhhhhhhhhhhh...eeee....ee..ee............eee..eeeeeeeeee...eeeeeeeeee..eeeeeeeeeeeee..........hhhhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
seq num:  ..1678      1688      1698      1708      1718      1728      1738      1748      1763      1773      1783      1793      1803      1813      1823      1833      1843      1853      1863      1873      1883      1893      1903      1913      1923      1933      1943      1953      1963    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||   |  |      |  |  ||| |   | || || ^***|| ||  || || |  |   |  |      | | ^***       | |      |  |  |       | |          |  |         | |           ||   |  || ||                       |  |  | |        | || |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*^*   |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |  |       | |          |  |         | |           ||   |  || ||                       |  |  | |        | || |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |  |       | |          |  |         | |           ||   |  |^**|                       |  |  | |        ^**| |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |      |  |  ||| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  ^***       | |          |  |         | |           ||   |  |^***                       |  |  | |        ^*** |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |      *******^| |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  | |             |  | |    || | ||||  |  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  ^*****             |  | ^*****| | |^*****  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHATASE_1 ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  |               |  |       **^********  ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |      |  |  | | |   | || || ||  || |***** || |  |   |  |      | |            | |      |  |          | |          |  |         | |           ||   |  |                           |  |  |               |  |           ||||     ||      || ||           *****  || |   |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         ***           ||   |  |                           |  |  |               |  |           ||||     ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |      |  |  | | |   | || || ||  || ||  || || |  |   |  |      | |            | |      |  |          | |          |  |         | |           **   |  |                           |  |  |               |  |           ||||     ||      || ||           |  ||  || |   |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****      |  |  | | |   **** || ||  ***********| |  |   |  |      | |            | |      ****          | |          ****         | |                |  |                           ****  |               ****           ||||     ||      ****|           ****|  || |   |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |  *** |     |  |***|   |  |   |  | |  |   |  |      | |            ***                    ***             |         | |                |  |                                 |                              ****     ||       |  |               |  |***   |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****  |   |     ********   ****   **** ****   ****      ***                                                   |         ***                ****                                 |                                ||     ||       ****               ****  |   |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                      |   |                                                                                                   |                                                                 |                                ||     ||                                *****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      *****                                                                                                   |                                                                 |                                ||     ||                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                 *                                **     **                                                      

   New search    2h03:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors