triangle PDBeMotif: 2gtp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Fri, Apr 28, 2006
Title crystal structure of the heterodimeric complex of human rgs1 activated gi alpha 1
Authors A.EDWARDS, A.P.TURNBULL, C.ARROWSMITH, D.A.DOYLE, E.UGOCHUKWU, F.GORREC, F.VON DELF, GENOMICS CONSORTIUM (SGC), J.WEIGELT, M.SOUNDARARAJAN, M.SUNDSTROM, STRU
Method X-RAY DIFFRACTION (resolution: 2.55Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP   search ALF ALF binding statistics ALF
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
Chains C,D sequence:
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GUANINE NUCLEOTIDE-BINDING PROTEIN G(I), ALPHA-1
member of: CATH:search1.10.400.10/search3.40.50.300GENE3D:searchG3DSA_1.10.400.10/searchG3DSA_3.40.50.300PANTHER:searchPTHR10218/searchPTHR10218_SF173PFAM:searchPF00503PRINTS:searchGPROTEINA/searchGPROTEINAISMART:searchSM00275SUPERFAMILY:searchSSF47895/searchSSF52540UniProt:searchP63096
JMol viewer RasMol script viewer  GDP 402A  ..           * ****                                                               ..                                                        ****                                                                                          ** **                                                   ***                     
JMol viewer RasMol script viewer  ALF 355A  ..          ** |*||                                                               ..                                                        |||* **                     **                                                                || ||                                                   |||                     
JMol viewer RasMol script viewer  MG 401A  ..          || ||*|                                                               ..                                                        |||| |*                     ||                                                                || ||                                                   |||                     
sec str:  ...eeeeeeee....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh......hhhhhhh.......eeeeeeee..eeeeeeee..hhhhhhhhhhhh....eeeeeee.hhhh.ee..eeeeehhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhh...hhhhh........hhhhhhhhhhhhhhh.........eeeee....hhhhhhhhhhhhhhhhhhhh.
sequence :  ..REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA..MTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
seq num:  ..32        42        52        62        72        82        92        102       ..119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  |||||      |   | |||  |                         | |    | |           ..           |  | |    |^***|   ^***        |  |  |  |  ||  ||  | |    | |||||       | | |||  | |||| |         || ||    | |||   || |    |  | ||  |       | |    || || |  ||  |    |  |        || || |||||       |  |                    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  |||||      |   | |||  |                         | |    | |           ..           |  | |    | |  |               |  |  |  |  ||  ||  | |    | |||||       | | |||  | |||| |         || ||    | |||   || |    |  | ||  |       | |    || || |  ||  |    |  |        || || **^*|       |  |                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  |^**|      |   | |||  |                         | |    ^**           ..           |  | |    | |  |               |  |  |  |  ||  ||  | |    | ^**||       | | ^**  | |||| |         || ||    | |||   |^**    |  | ||  |       | |    || || |  ||  |    |  |        || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |||||      |   | ||^***                         | |                  ..           |  | |    | |  |               |  |  |  ^***|  ||  | |    | ^***|       | |  ||  | |||| |         ^***|    | |||   |       |  | ||  |       | |    || || |  ||  |    ^***        || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |  |||||      *******^                             | |                  ..           |  | |    | |  |               |  |  |  |   |  ||  | |    |  |  |       | |  ||  | |||| |          |  |    | |||   |       |  | ||  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****||          | |                              | |                  ..           |  | ^***** |  |               |  |  |  |   |  ||  | ^*****  |  |       ^*****|  | |||| |          |  |    | |||   |       |  | ||  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        ********          | |                              | |                  ..           |  |        |  |               |  |  |  |   |  ||  |         |  |         |  ||  | |||| |          |  |    | |||   |       |  | ||  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..           |||||          | |                              | |                  ..           |  |        |  |               |  |  |  |   |  ||  |         |  |         |  ||  | |||| |          |  |    | |||   |       |  | ||  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |||||          | |                              | |                  ..           |  |        |  |               |  |  |  |   |  ||  |         |  |         *****  | |||| |          |  |    | |||   |       |  | ||  |       | |    ***** *****  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |||||          | |                              | |                  ..           |  |        |  |               |  |  |  |   |  ||  |         |  |         |  ||  | |||| |          |  |    | ||*****       |  | ||  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |||||          | |                              | |                  ..           |  |        |  |               |  |  |  |   |  ||  |         |  |         |  ||  | |||| |          |  |    ***|            |  ***|  |       | |    || || |  ||  |                || ||  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |||||          | |                              | |                  ..           |  |        ****               |  |  |  |   ****|  |         ****         ***********|| |          |  |    |  |            |  |  ****       | |    ****| ********                ****|  |  |       ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..           *****          ***                              ***                  ..           |  |                           |  |  |  |   |  ||  |                      |        | || |          |  |    |  |            |  |  |  |       ***     |  |     |  |                 |  |  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..           |                                                                    ..           ****                           *******  |   ****|  |                      |        ******          ****    ****            ****  ****               ****     ****                 ****  ****       ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |                                                                    ..                                                   *****   |  |                      |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                                                                    ..                                                           *  *                      *                                                                                                                                                

chain D : REGULATOR OF G-PROTEIN SIGNALING 1
member of: CATH:search1.10.167.10/search1.10.196.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF34PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchQ08116
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.
sequence :  ..VLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQ
seq num:  ..60        70        80        90        100       110       120       130       140       150       160       170       180         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || ||| |  |   |  ^*** |   |  | ||||           |  |  |            | |  |             | |       |  |       |  |     || ||           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||| |  |   |  |    |   |  | ||||           |  |  |            | |  |             ^**       |  |       |  |     || ||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|| |  |   |  |    |   |  | ||||           |  ^***            | |  |                       ^***       ^***     || ||           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || |  |   |  |    |   |  | ||||           |  |               | |  |                       |  |                || ||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***** |  |   |  |    |   |  | ||||           |  |               | |  |                       |  |                || ||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *******  |   |  |    |   |  ****||           |  |               | ****                       ****                ****|           
search RasMol script viewer Motif-ligand binding stats  nest ..            |   |  |    |   |    ****           |  |               | |  |                                            |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..            |   ****    |   |                   ****               ******                                            ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..            *****       |   |                                                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****                                                                                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : GUANINE NUCLEOTIDE-BINDING PROTEIN G(I), ALPHA-1
member of: CATH:search1.10.400.10/search3.40.50.300GENE3D:searchG3DSA_1.10.400.10/searchG3DSA_3.40.50.300PANTHER:searchPTHR10218/searchPTHR10218_SF173PFAM:searchPF00503PRINTS:searchGPROTEINA/searchGPROTEINAISMART:searchSM00275SUPERFAMILY:searchSSF47895/searchSSF52540UniProt:searchP63096
JMol viewer RasMol script viewer  GDP 403B  ..           * ****                                                                                                                              ****                                                                                          ** **                                                   ***                     
JMol viewer RasMol script viewer  ALF 355B  ..          ** |*||                                                                                                                              |||* **                     **                                                                || ||                                                   |||                     
JMol viewer RasMol script viewer  MG 402B  ..          || ||*|                                                                                                                              |||| |*                     ||                                                                || ||                                                   |||                     
sec str:  ...eeeeeeee....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh......hhhhhhh.......eeeeeeee..eeeeeeee..hhhhhhhhhhhh....eeeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhh...hhhhh........hhhhhhhhhhhhhhh.........eeeee....hhhhhhhhhhhhhhhhhhhh.
sequence :  ..REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
seq num:  ..32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  |||||      |   | |||  |                         | |   |||||        |  | |  |           |  | | |  |^***|   ^***        |  |  |  |  ||  ||  | |    | |||||       | | |||  | |||| |         || ||    |  ||   || |    |  |  |  |       | |     |  | |  ||  |    |  |         |  | |||||       |  |                    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  |||||      |   | |||  |                         | |   |||||        |  | |  |           |  | | |  | |  |               |  |  |  |  ||  ||  | |    | |||||       | | |||  | |||| |         || ||    |  ||   || |    |  |  |  |       | |     |  | |  ||  |    |  |         |  | **^*|       |  |                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  |^**|      |   | |||  |                         | |   |^**|        |  | |  |           |  | | |  | |  |               |  |  |  |  ||  ||  | |    | ^**||       | | ^**  | |||| |         || ||    |  ||   |^**    |  |  |  |       | |     |  | |  ||  |    |  |         |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |||||      |   | ||^***                         | |   | |||        |  | |  |           |  | | |  | |  |               |  |  |  ^***|  ||  | |    | ^***|       | |  ||  | |||| |         ^***|    |  ||   |       |  |  |  |       | |     |  | |  ||  |    ^***         |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |  |||||      *******^                             | |   | |||        |  | |  |           |  | | |  | |  |               |  |  |  |   |  ||  | |    |  |  |       | |  ||  | |||| |          |  |    |  ||   |       |  |  |  |       | |     |  | |  ||  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****||          | |                              | |   | |||        |  | |  |           |  | ^***** |  |               |  |  |  |   |  ||  | ^*****  |  |       ^*****|  | |||| |          |  |    |  ||   |       |  |  |  |       | |     |  | |  ||  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        ********          | |                              | |   | |||        |  | |  |           |  |   |    |  |               |  |  |  |   |  ||  |         |  |       | |  ||  | |||| |          |  |    |  ||   |       |  |  |  |       | |     |  | |  ||  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..           |||||          | |                              | |   | |||        |  | |  |           |  |   |    |  |               |  |  |  |   |  ||  |         |  |       | |  ||  | |||| |          |  |    |  ||   |       |  |  |  |       | |     |  | |  ||  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |||||          | |                              | |   | |||        |  | |  |           |  |   |    |  |               |  |  |  |   |  ||  |         |  |       | *****  | |||| |          |  |    |  ||   |       |  |  |  |       | |     |  | *****  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |||||          | |                              | |   *****        |  | |  |           |  *****    |  |               |  |  |  |   |  ||  |         |  |       | |  ||  | |||| |          |  |    |  |*****       |  |  |  |       | |     |  | |  ||  |                 |  | ||  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |||||          | |                              | |   ***|         |  | |  |           |  |        |  |               |  |  |  |   |  ||  |         |  |       | |  ||  | |||| |          |  |    |  |            |  |  |  |       | |     |  | |  ||  |                 |  ***|  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |||||          | |                              | |   ****         **** |  |           |  |        ****               |  |  |  |   ****|  |         ****       | ***********|| |          |  |    |  |            |  ****  |       | |     |  | ********                 |  |  |  |       ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..           *****          ***                              ***                |  | |  |           |  |                           |  |  |  |   |  ||  |                    | |        | || |          |  |    |  |            |  |  |  |       ***     |  |     |  |                 |  |  |  |       |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..           |                                                                  **** ****           ****                           *******  |   ****|  |                    ***        ******          ****    ****            ****  ****               ****     ****                 ****  ****       ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |                                                                                                                              *****   |  |                      |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                                                                                                                                      *  *                      *                                                                                                                                                

chain C : REGULATOR OF G-PROTEIN SIGNALING 1
member of: CATH:search1.10.167.10/search1.10.196.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF34PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchQ08116
sec str:  ....hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.
sequence :  ..VLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQ
seq num:  ..60        70        80        90        100       110       120       130       140       150       160       170       180         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  || |  |    |  ^***|       | ||||           |  |  |            | |  |         |   | |       |  |       |  |     || ||           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  || |  |    |  |   |       | ||||           |  |  |            | |  |         |   ^**       |  |       |  |     || ||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***| |  |    |  |   |       | ||||           |  ^***            | |  |         |   |         ^***       ^***     || ||           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |   | |  |    |  |   |       | ||||           |  |               | |  |         |   |                             || ||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |   | |  |    |  *****       | ||||           |  |               | |  |         |   |                             || ||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   | ****    |  |           ****||           |  |               | ****         |   |                             ****|           
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |         |  |             ****           |  |               | |  |         |   |                              |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |         ****                            ****               ******         |   |                              ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****                                                                           |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                  *****                                             

   New search    2gtp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors