triangle PDBeMotif: 2gpv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Tue, Apr 18, 2006
Title estrogen related receptor-gamma ligand binding domain comple 4-hydroxy-tamoxifen and a smrt peptide
Authors A.B.MILLER, D.D.MCKEE, L.A.O, L.WANG, M.H.LAMBERT, MILLER, R.T.NOLTE, T.G.CONSLER, T.M.WILLSON, W.J.ZUERCHER
Method X-RAY DIFFRACTION (resolution: 2.85Å)
PDBe Citation   
Small molecules:    search OHT OHT binding statistics OHT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
PAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEI
LILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAV
QKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Chains G,H,I sequence:
TNMGLEAIIRKALMGKYDQWEE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 504E  ..                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  OHT 500A  ..                                 *  **  ** **                             *         *         *               *  *   *                                                                                 *  **                    
sec str:  .....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh
sequence :  ..KPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |        | || |   | | ||||           || ||  |  ||  ||               | | |||| ||   |  |  |   |  ||||          |  |^**|| ||| ^**      | | ||                        |  |            |   |^**          | |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |        | ^***   | | ^***           || ||  |  |^***|               | | ||^***|   |  |  |   |  ||||          |  |||||| ||| |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..          |  |        | ||     | | |||            || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||| ||| |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |        | ||     | *****            || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||***** |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |        ***|     | | ||             || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||| ||  |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |        |  |     | ****             *****  ****|   |               | ******  |   ****  |   |  ||||          |  ****|****  |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |        |  |     |   |               |  |  |  ||   |               |   |  |  |         |   |  ||||          |   || |  |   |        | | ||                        |  |            |   |             ***            
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |        |  |     |   |               |  |  |  ||   |               |   |  |  |         |   |  ****          |   |***  |   |        *** ||                        |  |            |   |                            
search RasMol script viewer Motif-ligand binding stats  niche ..          ****        ****     |   |               ****  ****|   |               |   *******         |   |                |   |     |   |          ****                        ****            |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                         *****               |   |               |   |                |   |     |   |          | |                                         |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                             *****               *****                *****     *****          | |                                         *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                   ***                                                                          

chain B : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 503D  ..                                                                                                                                                                                                                     *         
JMol viewer RasMol script viewer  OHT 501B  ..                                   **  ** **                            **  *      *         *                      *                                                                                 *  **          |         
sec str:  ....hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |  ||  ||  |            |  | || |||  ||               |   | || ||   |  |  |   |  ||||          |   ^**||  || ^**      | | || |   |                  |  |          |  ||  ^**    |  || ||||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***  ||  |^***            |  | || ||^***|               |   | ^***|   |  |  |   |  ||||          |   || ||  ||          | | || |   |                  |  |          |  ||         |  || ||||           
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  |   |  ||||          |   || ||  ||          | | || |   |                  |  |          |  ||         |  || ||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  |   |  ||||          |   || |*****          | | || |   |                  |  |          *****         ***** ||||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  *****  ||||          |   || ||  |           | | || *****                  |  |          |  |          |  |  ||||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |    ||  ||               **** ****||   |               |   |  |  |   ****         ||||          |   || |****           | | ||                        |  |          ****          ****  ||||           
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |    ||  ||               |  |  |  ||   |               |   |  |  |   |  |         ****          |   |***               *** ||                        |  |                              ****           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****    ||  ||               ****  ****|   |               |   *******   ****                       |   |                    ****                        ****                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             ||  ||                         *****               |   |                                    |   |                    | |                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             ******                                             *****                                    *****                    | |                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                                          

chain C : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 502C  ..                                *  **  ** **                             *  *      *         *               *  *   *                                                                                 *  **                    
sec str:  ....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |  |   ||  |           || || || |||  ||               |   | || |    |  |  | |    ||||          |   ^**|  |   ^**      | | ||                        |  |      |  |  |   |^**          |||||  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***  |   |^***           || || || ||^***|               |   | ^***    |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  ||      
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        | ||    |   |               || || || |||   |               |   |  |      |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        | ||    |   |               || || || |||   |               |   |  |      |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             ||||*****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |        ***|    |   |               || || || |||   |               |   |  |      |  |  ***    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |    |   |               ****| ****||   |               |   |  |      ****         ||||          |   || |  |   |        | | ||                        |  |      ****  |   |             ||||****       
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |    |   |                |  |  |  ||   |               |   |  |      |  |         ****          |   |***  |   |        *** ||                        |  |            |   |             ****           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****    |   |                ****  ****|   |               |   ****      ****                       |   |     |   |          ****                        ****            |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             |   |                          *****               |   |                                    |   |     |   |          | |                                         |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****                                              *****                                    *****     *****          | |                                         *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                                          

chain D : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 503D  ..                                   ** *** *                             **  *      *         *               *  *                                                                                     *  **      
sec str:  ....hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |       |  |            |  | ||| || ||| |             |   | || ||   |  |         ||||    |  || |  |^**|| ||| ^**      | |                           |  | |               ^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***       ^***            |  | ||| |^***| |             |   | ^***|   |  |         ||||    |  || |  |||||| ||| |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        | ||                         |  | ||| || | | |             |   |  |  |   |  |         ||||    |  || |  |||||| ||| |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        | ||                         |  | ||| || | | |             |   |  |  |   |  |         ||||    ***** |  |||||***** |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |        ***|                         |  | ||| || | | |             |   |  |  |   |  |         ||||    |  |  |  |||||| ||  |        | |                           |  ***                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |                         |  | ||| || | | |             |   |  |  |   |  |         ||||    ****  |  ****|****  |        | |                           |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |                         |  | *** || | | |             |   |  |  |   |  |         ****          |   |***  |   |        ***                           |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****                         ****  ****| | | |             |   *******   ****                       |   |     |   |                                      ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                            ***** |             |   |                                    |   |     |   |                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                              *****             *****                                    *****     *****                                                                         

chain E : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 504E  ..                                  *   ** *                             *   *      *         *               *      *                                                                                    **      
sec str:  ...hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLE
seq num:  ..234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |    |  |        | || |  ||  ||  |           || || ||| ||  ||               |   | || ||   |  |         ||||          |   ^**|| ||| ^**      | | |                         |  |                 ^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |    |  |        | ^***  ||  |^***           || || ||| |^***|               |   | ^***|   |  |         ||||          |   || || ||| |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER .. | |    |  |        |  |    ||  ||              || || ||| ||   |               |   |  |  |   |  |         ||||          |   || || ||| |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |    |  |        |  |    ||  ||              ***** ||| ||   |               |   |  |  |   |  |         ||||          |   || |***** |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***    |  |        |  |    ||  ||              || || ||| ||   |               |   |  |  |   |  |         ||||          |   || || ||  |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |        |  |    ||  ||              ***** ||| ||   |               |   |  |  |   ****         ||||          |   || |****  |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |        |  |    ||  ||               |  | *** ||   |               |   |  |  |   |  |         ****          |   |***  |   |        *** |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..        ****        ****    ||  ||               ****  ****|   |               |   *******   ****                       |   |     |   |          | |                         ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            ||  ||                         *****               |   |                                    |   |     |   |          | |                                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            ******                                             *****                                    *****     *****          | |                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                 ***                                                            

chain F : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 505F  ..                                *   *  ** *                             **  *                *               *      *                                                                                 *  **     
sec str:  ....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKL
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   |  |  |        | || |  |   ||  |           || || ||| || ||| |              |  | || ||   |  |  |   || ||||          |   ^**|| ||| ^**      | | |    |  ||                |  |                 ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   |  |  |        | ^***  |   |^***           || || ||| |^***| |              |  | ^***|   |  |  |   || ||||          |   || || ||| |        | | |    |  ||                |  |                              
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  |   || ||||          |   || || ||| |        | | |    |  ||                |  |                              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  |   || ||||          |   || |***** |        | | |    *****                |  |                              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  *****| ||||          |   || || ||  |        | | |    |  |                 |  |                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |  |  |        |  |    |   |               ********| || | | |              ****  |  |   ****       ****||          |   || |****  |        | | |    ****                 |  |                              
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |  |  |        |  |    |   |                |  | *** || | | |                 |  |  |                ****          |   |***  |   |        *** |                         |  |                              
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |  ****        ****    |   |                ****  ****| | | |                 *******                              |   |     |   |          | |                         ****                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..  |   |                      |   |                          ***** |                                                      |   |     |   |          | |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..  *****                      *****                            *****                                                      *****     *****          | |                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                           

chain G : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 500A  ..*           
sec str:  ...hhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

chain H : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 501B  ..            
sec str:  ..hhhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

chain I : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 502C  ..*           
sec str:  ..hhhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 504E  ..                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  OHT 500A  ..                                 *  **  ** **                             *         *         *               *  *   *                                                                                 *  **                    
sec str:  .....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh
sequence :  ..KPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |        | || |   | | ||||           || ||  |  ||  ||               | | |||| ||   |  |  |   |  ||||          |  |^**|| ||| ^**      | | ||                        |  |            |   |^**          | |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |        | ^***   | | ^***           || ||  |  |^***|               | | ||^***|   |  |  |   |  ||||          |  |||||| ||| |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..          |  |        | ||     | | |||            || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||| ||| |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |        | ||     | *****            || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||***** |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |        ***|     | | ||             || ||  |  ||   |               | | || |  |   |  |  |   |  ||||          |  |||||| ||  |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |        |  |     | ****             *****  ****|   |               | ******  |   ****  |   |  ||||          |  ****|****  |        | | ||                        |  |            |   |             | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |        |  |     |   |               |  |  |  ||   |               |   |  |  |         |   |  ||||          |   || |  |   |        | | ||                        |  |            |   |             ***            
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |        |  |     |   |               |  |  |  ||   |               |   |  |  |         |   |  ****          |   |***  |   |        *** ||                        |  |            |   |                            
search RasMol script viewer Motif-ligand binding stats  niche ..          ****        ****     |   |               ****  ****|   |               |   *******         |   |                |   |     |   |          ****                        ****            |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                         *****               |   |               |   |                |   |     |   |          | |                                         |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                             *****               *****                *****     *****          | |                                         *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                   ***                                                                          

chain B : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 503D  ..                                                                                                                                                                                                                     *         
JMol viewer RasMol script viewer  OHT 501B  ..                                   **  ** **                            **  *      *         *                      *                                                                                 *  **          |         
sec str:  ....hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |  ||  ||  |            |  | || |||  ||               |   | || ||   |  |  |   |  ||||          |   ^**||  || ^**      | | || |   |                  |  |          |  ||  ^**    |  || ||||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***  ||  |^***            |  | || ||^***|               |   | ^***|   |  |  |   |  ||||          |   || ||  ||          | | || |   |                  |  |          |  ||         |  || ||||           
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  |   |  ||||          |   || ||  ||          | | || |   |                  |  |          |  ||         |  || ||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  |   |  ||||          |   || |*****          | | || |   |                  |  |          *****         ***** ||||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |        |  |    ||  ||               |  | || |||   |               |   |  |  |   |  |  *****  ||||          |   || ||  |           | | || *****                  |  |          |  |          |  |  ||||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |    ||  ||               **** ****||   |               |   |  |  |   ****         ||||          |   || |****           | | ||                        |  |          ****          ****  ||||           
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |    ||  ||               |  |  |  ||   |               |   |  |  |   |  |         ****          |   |***               *** ||                        |  |                              ****           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****    ||  ||               ****  ****|   |               |   *******   ****                       |   |                    ****                        ****                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             ||  ||                         *****               |   |                                    |   |                    | |                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             ******                                             *****                                    *****                    | |                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                                          

chain C : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 505F  ..                                                                                                                                                                                                                     *         
JMol viewer RasMol script viewer  OHT 502C  ..                                *  **  ** **                             *  *      *         *               *  *   *                                                                                 *  **          |         
sec str:  ....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |  |   ||  |           || || || |||  ||               |   | || |    |  |  | |    ||||          |   ^**|  |   ^**      | | ||                        |  |      |  |  |   |^**          |||||  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***  |   |^***           || || || ||^***|               |   | ^***    |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  ||      
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        | ||    |   |               || || || |||   |               |   |  |      |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        | ||    |   |               || || || |||   |               |   |  |      |  |  | |    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             ||||*****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |        ***|    |   |               || || || |||   |               |   |  |      |  |  ***    ||||          |   || |  |   |        | | ||                        |  |      |  |  |   |             |||||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |    |   |               ****| ****||   |               |   |  |      ****         ||||          |   || |  |   |        | | ||                        |  |      ****  |   |             ||||****       
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |    |   |                |  |  |  ||   |               |   |  |      |  |         ****          |   |***  |   |        *** ||                        |  |            |   |             ****           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****    |   |                ****  ****|   |               |   ****      ****                       |   |     |   |          ****                        ****            |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             |   |                          *****               |   |                                    |   |     |   |          | |                                         |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****                                              *****                                    *****     *****          | |                                         *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                                          

chain D : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 503D  ..                                   ** *** *                             **  *      *         *               *  *                                                                                     *  **      
sec str:  ....hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLE
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |        | || |       |  |            |  | ||| || ||| |             |   | || ||   |  |         ||||    |  || |  |^**|| ||| ^**      | |                           |  | |               ^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |        | ^***       ^***            |  | ||| |^***| |             |   | ^***|   |  |         ||||    |  || |  |||||| ||| |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..         |  |        | ||                         |  | ||| || | | |             |   |  |  |   |  |         ||||    |  || |  |||||| ||| |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |        | ||                         |  | ||| || | | |             |   |  |  |   |  |         ||||    ***** |  |||||***** |        | |                           |  | |                             
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |        ***|                         |  | ||| || | | |             |   |  |  |   |  |         ||||    |  |  |  |||||| ||  |        | |                           |  ***                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |        |  |                         |  | ||| || | | |             |   |  |  |   |  |         ||||    ****  |  ****|****  |        | |                           |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |        |  |                         |  | *** || | | |             |   |  |  |   |  |         ****          |   |***  |   |        ***                           |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****                         ****  ****| | | |             |   *******   ****                       |   |     |   |                                      ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                            ***** |             |   |                                    |   |     |   |                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                              *****             *****                                    *****     *****                                                                         

chain E : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 504E  ..                                  *   ** *                             *   *      *         *               *      *                                                                                    **      
sec str:  ...hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLE
seq num:  ..234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |    |  |        | || |  ||  ||  |           || || ||| ||  ||               |   | || ||   |  |         ||||          |   ^**|| ||| ^**      | | |                         |  |                 ^**           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |    |  |        | ^***  ||  |^***           || || ||| |^***|               |   | ^***|   |  |         ||||          |   || || ||| |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER .. | |    |  |        |  |    ||  ||              || || ||| ||   |               |   |  |  |   |  |         ||||          |   || || ||| |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |    |  |        |  |    ||  ||              ***** ||| ||   |               |   |  |  |   |  |         ||||          |   || |***** |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***    |  |        |  |    ||  ||              || || ||| ||   |               |   |  |  |   |  |         ||||          |   || || ||  |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |        |  |    ||  ||              ***** ||| ||   |               |   |  |  |   ****         ||||          |   || |****  |        | | |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |        |  |    ||  ||               |  | *** ||   |               |   |  |  |   |  |         ****          |   |***  |   |        *** |                         |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..        ****        ****    ||  ||               ****  ****|   |               |   *******   ****                       |   |     |   |          | |                         ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            ||  ||                         *****               |   |                                    |   |     |   |          | |                                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            ******                                             *****                                    *****     *****          | |                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                 ***                                                            

chain F : ESTROGEN-RELATED RECEPTOR GAMMA
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084PFAM:searchPF00104PIRSF:searchPIRSF002527/searchPIRSF500939PRINTS:searchRETNOICACIDR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP62508
JMol viewer RasMol script viewer  OHT 505F  ..                                *   *  ** *                             **  *                *               *      *                                                                                 *  **     
sec str:  ....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..eeeehhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..PYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKL
seq num:  ..233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   |  |  |        | || |  |   ||  |           || || ||| || ||| |              |  | || ||   |  |  |   || ||||          |   ^**|| ||| ^**      | | |    |  ||                |  |                 ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   |  |  |        | ^***  |   |^***           || || ||| |^***| |              |  | ^***|   |  |  |   || ||||          |   || || ||| |        | | |    |  ||                |  |                              
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  |   || ||||          |   || || ||| |        | | |    |  ||                |  |                              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  |   || ||||          |   || |***** |        | | |    *****                |  |                              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |   |  |  |        |  |    |   |               || || ||| || | | |              |  |  |  |   |  |  *****| ||||          |   || || ||  |        | | |    |  |                 |  |                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |  |  |        |  |    |   |               ********| || | | |              ****  |  |   ****       ****||          |   || |****  |        | | |    ****                 |  |                              
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |  |  |        |  |    |   |                |  | *** || | | |                 |  |  |                ****          |   |***  |   |        *** |                         |  |                              
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |  ****        ****    |   |                ****  ****| | | |                 *******                              |   |     |   |          | |                         ****                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..  |   |                      |   |                          ***** |                                                      |   |     |   |          | |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..  *****                      *****                            *****                                                      *****     *****          | |                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                           

chain G : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 500A  ..*           
sec str:  ...hhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

chain H : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 501B  ..            
sec str:  ..hhhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

chain I : NUCLEAR RECEPTOR COREPRESSOR 2
member of: PANTHER:searchPTHR13992/searchPTHR13992_SF21UniProt:searchQ4RA23
JMol viewer RasMol script viewer  OHT 502C  ..*           
sec str:  ..hhhhhhhhhhhh
sequence :  ..GLEAIIRKALMG
seq num:  ..1319        

   New search    2gpv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors