triangle PDBeMotif: 2gp0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.48
Classification hydrolase    | release date: Sat, Apr 15, 2006
Title heptp catalytic domain (residues 44-339), s225d mutant
Authors R.PAGE
Method X-RAY DIFFRACTION (resolution: 2.05Å)
PDBe Citation   
Small molecules:    search PO4 PO4 binding statistics PO4   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRDVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 7
member of: CATH:search3.90.190.10GENE3D:searchG3DSA_3.90.190.10PANTHER:searchPTHR19134/searchPTHR19134_SF39PFAM:searchPF00102PRINTS:searchKIMPTPASE/searchPRTYPHPHTASEPROSITE PATTERNS:searchPS00383, PROSITE PROFILES:searchPS50055/searchPS50056, SMART:searchSM00194SUPERFAMILY:searchSSF52799UniProt:searchP35236
JMol viewer RasMol script viewer  GOL 437A  ..                                                                    **                   *       **                                    ..                                                                                                                                                         
JMol viewer RasMol script viewer  PO4 436A  ..                                                                    ||                   |       ||                                    ..                                                     *                                 *** ***                                     *                     
sec str:  ...hhhhhhhhhhhhh..eeehhhhhhh..hhhhhhhhhhhh.....hhhhh...hhhhhh.......hhh.eee...........eeeeeee.hhhhh...eeeee..hhhhhhhhhhhhhhh...eeeee...............eeee..eeeeeeeeee...eeeeeeeeee..eeeeeeeeee..........hhhhhhhhhhhhhhh.........eeeee...hhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..
sequence :  ..NTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLRE..CVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRDVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPE
seq num:  ..44        54        64        74        84        94        104       114       124       134       144       154       164       174  ..183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**||  | | ||              ^**     |  | | | || || | ||| || |  |   |  |   ||||| ||          |  |  | |      |  |  |       | |           ..      |  |  | |         |  |^**      | |             |               ||  | | |       ||| |||||||              | | |   |    |  | ||  ||  |         || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|  | | ||                      |  | | | ^***| | ||| || |  |   |  |   ||||^***          |  |  | |      |  ^***       | |           ..      ^***  | |         |  |         | |             |               ||  | | |       ||| |||||||              | | |   |    |  | ||  ||  |         || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |   |  | | ||                      |  | | | || || | ||| || |  |   |  |   ||||| |           |  |  | |      |  |          | |           ..            | |         |  |         | |             |               ||  | | |       ||| |^*****              | | |   |    |  | ^*****  |         || ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHATASE_1 .. |   |  | | ||                      |  | | | || || | ||| || |  |   |  |   ||||| |           |  |  | |      |  |          | |           ..            | |         |  |         | |             |               ||  | | |       **^********              | | |   |    |  |  |  |   |         || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |  | | ||                      |  | | | || || | |***** |  |   |  |   ||||| |           |  |  | |      |  |          | |           ..            | |         |  |         | |             |               ||  | | |        || ||||||               | | |   |    |  |  |  |   |         || ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |   |  | | ||                      |  | | | || || | ||| || |  |   |  |   ||||| |           |  |  | |      |  |          | |           ..            | |         |  |         | |             |               ||  | | |        || ||||||               | | *****    |  |  |  |   |         || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |  | | ||                      |  | | | ****| *******| |  |   |  |   ||||| |           ****  | |      ****          | |           ..            | |         |  |         | |             |               ||  | | |        || ||||||               | |          |  |  |  |   |         ****|  
search RasMol script viewer Motif-ligand binding stats  nest .. |   |  | | ||                      |  | ***  |  |   ***  | |  |   |  |   ****| |                 ***                    ***           ..            | |         |  |         | |             |               ||  | | |        || ****||               ***          |  |  |  |   |          |  |  
search RasMol script viewer Motif-ligand binding stats  niche .. |   |  | ****                      **** | |  ****     **** ****   ****    ******                                                      ..            ***         ****         ***             |               |**** ***        ||     ||                            *******  |   |          ****  
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****  |   |                            | |                                  | |                                                      ..                                                     |               |   |            ||     ||                                     *****                
search RasMol script viewer Motif-ligand binding stats  ststaple ..        *****                            | |                                  | |                                                      ..                                                     |               *****            ||     ||                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                  ***                                                      ..                                                     |                                ||     ||                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       ..                                                     *                                **     **                                                          

   New search    2gp0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors