triangle PDBeMotif: 2ger  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.5.1.2
Classification oxidoreductase    | release date: Mon, Mar 20, 2006
Title crystal structure and oxidative mechanism of human pyrroline carboxylate reductase
Authors Z.LIU, Z.LOU, Z.MENG, Z.RAO
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E sequence:
RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI
LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGF
CTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGK
D
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eee..hhhhhhhhhhhhhhh.......eeee......hhhhhhhhhh.eee...hhhhhhh.eeee......hhhhhh..........eeee.....hhhhhhh..........eeeee.hhhhhh..ee.eeee......hhhhhhhhhhhh.ee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 |   | ||||  |    |  |    |  |   | |  | |     | |              |  || | ||  |   | | ||  || || ||             || || | |                     |  ||  |  ||  | | |||   |  |  |  ||  |||  | |                | ||| || ||    |^***          |||||||| |||  |          ||  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                 |   | ||||  |    |  |    |  |   | |  | |     | |              |  || | ||  |   | | ||  || |**^*             || || | |                     |  ||  |  ||  | | |||   |  |  |  ||  |||  | |                | ||| || ||    |  |           |||||||| |||  |          ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |   | ||||  |    ^***    |  |   | |  | |     | |              |  || | ||  |   | | ||  ^***                 || || | |                     |  ||  ^***|  | | |||   |  |  ^***|  |||  | |                | ||| || ||    |  |           |||||||| |||  |          |^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |   | |^*****            |  |   | |  | |     | |              |  || | ||  |   | | ^*****                   || || | |                     |  ||      |  | | |^*****  |      |  ||^*****                | ||| || ||    |  |           ||||^*****||  |          |   |  
search RasMol script viewer Motif-ligand binding stats  P5CR ..                 |   | ||||               |  |   | |  | |     | |              |  || | ||  |   | |  |                       || || | |                     |  ||      |  | | |||   |  |      |  |||  |                  | ||| || |***********************|||||  ||  |          |   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |   | ||||               |  |   | |  | |     | |              ***** | ||  |   | |  |                       || || | |                     *****      |  | *****   |  |      *****|  |                  ***** || |     |  |           || ||||*****  |          *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |   ****||               ****   | |  | |     | |              ****  | ||  |   | |  |                       ***** | |                     ****       **** ****    ****      **** ****                  ****  || |     |  |           *****||********                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   | ||||                      | |  | |     | |                    | ||  |   | |  |                             | |                                   |   |                                            |   |***     |  |               ||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   | ****                      ***  | |     | |                    | ||  |   | |  |                             | |                                   |   |                                            |   |        |  |               ****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                ***     ***                    *******   ******                             ***                                   |   |                                            |   |        ****                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                                  *****                                            *****                                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  .......ee...hhhhhhhhh.............ee........hhhhh............hhhhh....ee.......hhhhhhhhh........eee.....hhhhhh...........eeeee.hhhhhh.....eee.........hhhhhhhhh........hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVK..TPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49 ..53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | |    | | || |  || | | | |  ||     ..    ||||| |    | |       |  ||               |   || || ||              || ||| |           | ||  |   |  |   |  |  || | ||    |     |  |   | ||||||                  |   || ||    |^***    |  || |||||||| ||  ||   || ||| || ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                 | |    | | || |  || | | | |  ||     ..    ||||| |    | |       |  ||               |   || |**^*              || ||| |           | ||  |   |  |   |  |  || | ||    |     |  |   | ||||||                  |   || ||    |  |     |  || |||||||| ||  ||   || ||| || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 | |    | | || |  ^*** | | |  ||     ..    ||||| |    | |       |  ||               |   ^***                  || ||| |           | ||  |   |  |   ^***  || | ||    |     ^***   | ||||||                  |   || ||    |  |     |  || |||||||| ||  ||   || ||| |^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | |    ^***** |   | | | | |  ||     ..    ||||| |    | |       |  ||               ^*****                    || ||| |           | ||  |   |  |         || | |^*****            | ^*****                  |   || ||    |  |     |  || ||||^*****|  ||   || ||| |  ||  
search RasMol script viewer Motif-ligand binding stats  P5CR ..                 | |    | | |  |   | | | | |  ||     ..    ||||| |    | |       |  ||                                         || ||| |           | ||  |   |  |         || | |                  |  |||||                  |   || |***********************|||||  |  ||   || ||| |  ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 | |    | | |  |   | | | | *****     ..    ||||| |    | |       *****                                         || ||| |           | ||  |   |  |         || | |                  *****|||                  |   || |     |  |     ***** *****|||  *****   ****** *****  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |    | | |  |   | | *** |  |      ..    ||||| |    | |       |  |                                          || ||| |           | ||  |   |  |         || | |                  |  | |||                  |   || |     |  |     |  |  || |||||  |  |    || ||  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    | | |  |   | |     ****      ..    ***** |    | |       ****                                          *****| |           *******   ****         **** |                  *******|                  |   || |     ****     ****  *****||*******    *****  ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 | |    *** |  |   ***               ..      | | |    ***                                                          | |           ***                     |   |                       | |                  |   |***     |  |               ||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                 | |        |  |                     ..      | | |                                                                 | |                                   |   |                       ***                  |   |        |  |               ****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                 ***        ****                     ..      | ***                                                                 ***                                   |   |                                            |   |        ****                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                     ..      *****                                                                                                       *****                                            *****                                                       

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......ee.....hhhhhhhhhhhhhh......ee......hhhhhhhhhhhhh......hhhhhh...........hhhhhhhhhhhhh.............hhhhhhhhhh........eeee.hhhhhh...eeeeee..........hhhhhh....eeee....hhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.......hhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhh..
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                       ||| | |    || |      |  | |||      ||||| |   | | |  |        |  | | |     | ||  || || ||              |  |           | |                  |  |  || |||||  || ||  |  |    || || |                    | | | |    |^***       || ||| || | |               |||||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                       ||| | |    || |      |  | |||      ||||| |   | | |  |        |  | | |     | ||  || |**^*              |  |           | |                  |  |  || |||||  || ||  |  |    || || |                    | | | |    |  |        || ||| || | |               |||||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                       ||| | |    ^***      |  | |||      ||||| |   | | |  |        |  | | |     | ||  ^***                  |  |           | |                  ^***  || |||||  || ||  ^***    || || |                    | | | |    |  |        || ||| || | |               |^***| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                       |^*****     | |      |  | |||      ||||| |   | | |  |        |  | | |     | ^*****                    |  |           | |                        || |||^***** ||  |       |^*****                    | | | |    |  |        || ||| ^*****               | |||| 
search RasMol script viewer Motif-ligand binding stats  P5CR ..                       | | | |     | |      |  | |||      ||||| |   | | |  |        |  | | |     |  |                        |  |           | |                        || ||| |  || ||  |       |  ||                      | | | ***********************  | |                 | |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | | | |     | |      |  | |||      ||||| |   | | |  |        |  | | |     |  |                        |  |           | |                        || ||| |  || ||  |       *****                      | | |      |  |        ******  | |                 *****| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | | | |     | |      *******|      ***** |   | | ****        |  | | |     |  |                        ****           | |                        ********  *****  |       ****                       | | |      |  |        *****   | |                 ****** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       | | ***     ***           | |        |   |   ***             |  | | |     |  |                                       ***                         |   |       |   |                                  | | |      |  |                | |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***                       ***        |   |                   |  | | |     |  |                                                                   |   |       |   |                                  | | |      |  |                ***                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            |   |                   **** ***     ****                                                                   |   |       |   |                                  *****      ****                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                            *****                                                                                                       *****       *****                                                                                            

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eee...hhhhhhhhhhhhhhh..hhh.eeee......hhhhhhhhhh.eee.hhhhhhhh..eeee.....hhhhhhhhhhh......eeeee....hhhhhhhhhh.......eeeee.hhhhhh..eeeeee.....hhhhhhhhhhhh...eeeee......hhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  |   |   | ||||  |    |  |       |  || |  | |   || ||    | ||  |  |  | || ||          |||  || ||||||             || |||||              |  || |||     |  |  ||   ||    |   | ||||     || |||                | ||| |   |   ||^***    |  || ||| |||||| |   |  ||      |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          |  |   |   | ||||  |    |  |       |  || |  | |   || ||    | ||  |  |  | || ||          |||  || |**^*|             || |||||              |  || |||     |  |  ||   ||    |   | ||||     || |||                | ||| |   |   || ||     |  || ||| |||||| |   |  ||      |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |   |   | ||||  |    ^***       |  || |  | |   || ||    | ||  |  |  | || ||          |||  ^***||  |             || |||||              |  || |||     ^***  ||   ||    |   | ^***     || |||                | ||| |   |   || ||     |  || ||| |||||| |   |  ||      ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |   |   | |^*****               |  || |  | |   || ||    | ||  |  |  | || ||          |^***** |||  |             || |||||              |  || |||        |  ||   |^*****   |  ||      ^*****                | ||| |   |   || ||     |  || ||| ^***** |   |  ||            
search RasMol script viewer Motif-ligand binding stats  P5CR ..          |  |   |   | ||||                  |  || |  | |   || ||    | ||  |  |  | || ||          | |  |  |||  |             || |||||              |  || |||        |  ||   |         |  ||      || |||                | ||| |   *********************** |||||  |   |  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |   |   | ||||                  ***** |  | |   || ||    | ||  |  |  | *****          | |  *****|  |             |*****||              ********|        |  ||   |         *****      || |||                ***** |       || ||     ********  |||||  |   *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****   |   | ||||                  ****| |  | |   ****|    | |********** ****|          | |  **** ****             *****|||              ******* |        ****|   |         ****       |****|                ****  |       *****     ***********|||****   ****             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   | ||||                      | |  | |    |  |    ***            |  |          ***                            ||||                  |   |            |   |                    |  | |                  |   |        |  |               ||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   | ****                      ***  | |    |  |                   |  |                                         ****                  |   |            |   |                    |  ***                  |   |        |  |               ****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                ***    ****                   ****                                                               |   |            |   |                    |    |                  |   |        ****                                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                                                                 |   |            |   |                    ******                  |   |                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                 *****            *****                                            *****                                                       

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eeee..hhhhhhhhhhhhhh...hhh.eeee.........hhhhhh..eee.hhhhhhhhh.eeee.....hhhhhhh..........eeee.....hhhhhhhhhhh......eeeee.hhhhhhh..eeeeee.......hhhhhhhhhhhhheeee...hhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                    || |||||||||  |  |      |  |      | |    |  |                  || ||||||       |   || || ||              ||||||        |  |         | | ||   |  |  || | ||    |   | || |     |  | |        |  |           | || |  |^***       ||||||||||| |         |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                    || |||||||||  |  |      |  |      | |    |  |                  || ||||||       |   || |**^*              ||||||        |  |         | | ||   |  |  || | ||    |   | || |     |  | |        |  |           | || |  || |        ||||||||||| |         |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                    || |||||||||  ^***      |  |      | |    |  |                  || ||||||       |   ^***   |              ||||||        |  |         | | ||   ^***  || | ||    |   | ^***     |  | |        |  |           | || |  || |        ||||||||||| |         |  ||  ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                    || |^*****||            |  |      | |    |  |                  || ||||||       ^***** |   |              ||||||        |  |         | | ||         || | |^*****   |  |       ^*****        |  |           | || |  || |        |||||||^*****         |  ||        
search RasMol script viewer Motif-ligand binding stats  P5CR ..                    || |||||| ||            |  |      | |    |  |                  || ||||||              |   |              ||||||        |  |         | | ||         || | |         |  |          | |        |  |           | |***********************|||||           |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    || |||||| ||            |  |      | |    |  |                  *****||||              |   |              ||||||        |  |         | | ||         || | |         |  |          | |        |  |           | |  ***** |        *********||           *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    |****||****|            ****      | |    |  |                  ****|||||              |   |              ******        |  |         | ****         **** |         ****          | |        ****           | |  *******        ********|||           ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |||| |  |                      | |    |  |                   |  |***|              |   |                            |  |         |   |           | ***                       | |                       ***     |  |          |   |||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  **** |  |                      | |    |  |                   |  | | |              |   |                            |  |         |   |           |   |                       ***                               |  |          |   |****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                    |    |  ****                      ***    ****                   **** ***              |   |                            ****         |   |           |   |                                                         ****          |   |                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                    ******                                                                                |   |                                         |   |           |   |                                                                       |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                          *****                                         *****           *****                                                                       *****                            

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eee...hhhhhhhhhhhhhhh..hhh.eeee......hhhhhhhhhh.eee.hhhhhhhh..eeee.....hhhhhhhhhhh......eeeee....hhhhhhhhhh.......eeeee.hhhhhh..eeeeee.....hhhhhhhhhhhh...eeeee......hhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  |   |   | ||||  |    |  |       |  || |  | |   || ||    | ||  |  |  | || ||          |||  || ||||||             || |||||              |  || |||     |  |  ||   ||    |   | ||||     || |||                | ||| |   |   ||^***    |  || ||| |||||| |   |  ||      |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          |  |   |   | ||||  |    |  |       |  || |  | |   || ||    | ||  |  |  | || ||          |||  || |**^*|             || |||||              |  || |||     |  |  ||   ||    |   | ||||     || |||                | ||| |   |   || ||     |  || ||| |||||| |   |  ||      |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |   |   | ||||  |    ^***       |  || |  | |   || ||    | ||  |  |  | || ||          |||  ^***||  |             || |||||              |  || |||     ^***  ||   ||    |   | ^***     || |||                | ||| |   |   || ||     |  || ||| |||||| |   |  ||      ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |   |   | |^*****               |  || |  | |   || ||    | ||  |  |  | || ||          |^***** |||  |             || |||||              |  || |||        |  ||   |^*****   |  ||      ^*****                | ||| |   |   || ||     |  || ||| ^***** |   |  ||            
search RasMol script viewer Motif-ligand binding stats  P5CR ..          |  |   |   | ||||                  |  || |  | |   || ||    | ||  |  |  | || ||          | |  |  |||  |             || |||||              |  || |||        |  ||   |         |  ||      || |||                | ||| |   *********************** |||||  |   |  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |   |   | ||||                  ***** |  | |   || ||    | ||  |  |  | *****          | |  *****|  |             |*****||              ********|        |  ||   |         *****      || |||                ***** |       || ||     ********  |||||  |   *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****   |   | ||||                  ****| |  | |   ****|    | |********** ****|          | |  **** ****             *****|||              ******* |        ****|   |         ****       |****|                ****  |       *****     ***********|||****   ****             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   | ||||                      | |  | |    |  |    ***            |  |          ***                            ||||                  |   |            |   |                    |  | |                  |   |        |  |               ||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   | ****                      ***  | |    |  |                   |  |                                         ****                  |   |            |   |                    |  ***                  |   |        |  |               ****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                ***    ****                   ****                                                               |   |            |   |                    |    |                  |   |        ****                                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                                                                 |   |            |   |                    ******                  |   |                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                 *****            *****                                            *****                                                       

chain E : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eeee..hhhhhhhhhhhhhh...hhh.eeee.........hhhhhh..eee.hhhhhhhhh.eeee.....hhhhhhh..........eeee.....hhhhhhhhhhh......eeeee.hhhhhhh..eeeeee.......hhhhhhhhhhhhheeee...hhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                    || |||||||||  |  |      |  |      | |    |  |                  || ||||||       |   || || ||              ||||||        |  |         | | ||   |  |  || | ||    |   | || |     |  | |        |  |           | || |  |^***       ||||||||||| |         |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                    || |||||||||  |  |      |  |      | |    |  |                  || ||||||       |   || |**^*              ||||||        |  |         | | ||   |  |  || | ||    |   | || |     |  | |        |  |           | || |  || |        ||||||||||| |         |  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                    || |||||||||  ^***      |  |      | |    |  |                  || ||||||       |   ^***   |              ||||||        |  |         | | ||   ^***  || | ||    |   | ^***     |  | |        |  |           | || |  || |        ||||||||||| |         |  ||  ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                    || |^*****||            |  |      | |    |  |                  || ||||||       ^***** |   |              ||||||        |  |         | | ||         || | |^*****   |  |       ^*****        |  |           | || |  || |        |||||||^*****         |  ||        
search RasMol script viewer Motif-ligand binding stats  P5CR ..                    || |||||| ||            |  |      | |    |  |                  || ||||||              |   |              ||||||        |  |         | | ||         || | |         |  |          | |        |  |           | |***********************|||||           |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    || |||||| ||            |  |      | |    |  |                  *****||||              |   |              ||||||        |  |         | | ||         || | |         |  |          | |        |  |           | |  ***** |        *********||           *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    |****||****|            ****      | |    |  |                  ****|||||              |   |              ******        |  |         | ****         **** |         ****          | |        ****           | |  *******        ********|||           ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |||| |  |                      | |    |  |                   |  |***|              |   |                            |  |         |   |           | ***                       | |                       ***     |  |          |   |||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  **** |  |                      | |    |  |                   |  | | |              |   |                            |  |         |   |           |   |                       ***                               |  |          |   |****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                    |    |  ****                      ***    ****                   **** ***              |   |                            ****         |   |           |   |                                                         ****          |   |                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                    ******                                                                                |   |                                         |   |           |   |                                                                       |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                          *****                                         *****           *****                                                                       *****                            

Assembly 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......eee..hhhhhhhhhhhhhhh.......eeee......hhhhhhhhhh.eee...hhhhhhh.eeee......hhhhhh..........eeee.....hhhhhhh..........eeeee.hhhhhh..ee.eeee......hhhhhhhhhhhh.ee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh.......hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 |   | ||||  |    |  |    |  |   | |  | |     | |              |  || | ||  |   | | ||  || || ||             || || | |                     |  ||  |  ||  | | |||   |  |  |  ||  |||  | |                | ||| || ||    |^***          |||||||| |||  |          ||  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                 |   | ||||  |    |  |    |  |   | |  | |     | |              |  || | ||  |   | | ||  || |**^*             || || | |                     |  ||  |  ||  | | |||   |  |  |  ||  |||  | |                | ||| || ||    |  |           |||||||| |||  |          ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |   | ||||  |    ^***    |  |   | |  | |     | |              |  || | ||  |   | | ||  ^***                 || || | |                     |  ||  ^***|  | | |||   |  |  ^***|  |||  | |                | ||| || ||    |  |           |||||||| |||  |          |^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |   | |^*****            |  |   | |  | |     | |              |  || | ||  |   | | ^*****                   || || | |                     |  ||      |  | | |^*****  |      |  ||^*****                | ||| || ||    |  |           ||||^*****||  |          |   |  
search RasMol script viewer Motif-ligand binding stats  P5CR ..                 |   | ||||               |  |   | |  | |     | |              |  || | ||  |   | |  |                       || || | |                     |  ||      |  | | |||   |  |      |  |||  |                  | ||| || |***********************|||||  ||  |          |   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |   | ||||               |  |   | |  | |     | |              ***** | ||  |   | |  |                       || || | |                     *****      |  | *****   |  |      *****|  |                  ***** || |     |  |           || ||||*****  |          *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |   ****||               ****   | |  | |     | |              ****  | ||  |   | |  |                       ***** | |                     ****       **** ****    ****      **** ****                  ****  || |     |  |           *****||********                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |   | ||||                      | |  | |     | |                    | ||  |   | |  |                             | |                                   |   |                                            |   |***     |  |               ||||                        
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   | ****                      ***  | |     | |                    | ||  |   | |  |                             | |                                   |   |                                            |   |        |  |               ****                        
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                ***     ***                    *******   ******                             ***                                   |   |                                            |   |        ****                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                                  *****                                            *****                                                       

chain C : PYRROLINE-5-CARBOXYLATE REDUCTASE 1
member of: CATH:search1.10.3730.10/search3.40.50.720GENE3D:searchG3DSA_1.10.3730.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01925PANTHER:searchPTHR11645/searchPTHR11645_SF6PFAM:searchPF03807/searchPF14748PIRSF:searchPIRSF000193PROSITE PATTERNS:searchPS00521, SUPERFAMILY:searchSSF48179/searchSSF51735TIGRFAMS:searchTIGR00112UniProt:searchP32322
sec str:  ......ee.....hhhhhhhhhhhhhh......ee......hhhhhhhhhhhhh......hhhhhh...........hhhhhhhhhhhhh.............hhhhhhhhhh........eeee.hhhhhh...eeeeee..........hhhhhh....eeee....hhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.......hhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhh..
sequence :  ..RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                       ||| | |    || |      |  | |||      ||||| |   | | |  |        |  | | |     | ||  || || ||              |  |           | |                  |  |  || |||||  || ||  |  |    || || |                    | | | |    |^***       || ||| || | |               |||||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                       ||| | |    || |      |  | |||      ||||| |   | | |  |        |  | | |     | ||  || |**^*              |  |           | |                  |  |  || |||||  || ||  |  |    || || |                    | | | |    |  |        || ||| || | |               |||||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                       ||| | |    ^***      |  | |||      ||||| |   | | |  |        |  | | |     | ||  ^***                  |  |           | |                  ^***  || |||||  || ||  ^***    || || |                    | | | |    |  |        || ||| || | |               |^***| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                       |^*****     | |      |  | |||      ||||| |   | | |  |        |  | | |     | ^*****                    |  |           | |                        || |||^***** ||  |       |^*****                    | | | |    |  |        || ||| ^*****               | |||| 
search RasMol script viewer Motif-ligand binding stats  P5CR ..                       | | | |     | |      |  | |||      ||||| |   | | |  |        |  | | |     |  |                        |  |           | |                        || ||| |  || ||  |       |  ||                      | | | ***********************  | |                 | |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | | | |     | |      |  | |||      ||||| |   | | |  |        |  | | |     |  |                        |  |           | |                        || ||| |  || ||  |       *****                      | | |      |  |        ******  | |                 *****| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | | | |     | |      *******|      ***** |   | | ****        |  | | |     |  |                        ****           | |                        ********  *****  |       ****                       | | |      |  |        *****   | |                 ****** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       | | ***     ***           | |        |   |   ***             |  | | |     |  |                                       ***                         |   |       |   |                                  | | |      |  |                | |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***                       ***        |   |                   |  | | |     |  |                                                                   |   |       |   |                                  | | |      |  |                ***                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            |   |                   **** ***     ****                                                                   |   |       |   |                                  *****      ****                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                            *****                                                                                                       *****       *****                                                                                            

   New search    2ger:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors