triangle PDBeMotif: 2g9a  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification structural protein/dna binding protein    | release date: Mon, Mar 6, 2006
Title structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Authors H.WANG, J.CHAI, Y.SHEN, Z.HAN
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Modified residues:  search MLY MLY binding statistics MLY
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLV
SASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG
SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIF
ANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Chain B sequence:
ARTKQTARKS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : WD-REPEAT PROTEIN 5
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR22847/searchPTHR22847_SF308PFAM:searchPF00400PIRSF:searchPIRSF002394PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchP61964
sec str:  ..............eeeeee......eeeeee.....eeeeee...eeeeee.....eeeeee.....eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee.......eeeeee.....eeeeee...eeeeee....eeeeee...........eeee.....eeeee.....eeeee.....eeeee......eeeeee.....eeeeee......eeeee..
sequence :  ..GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
seq num:  ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              ||          | | | ||||   || | |    |  | |                   ||||| | ||| | |  || | |   | |      ||   | |||||   | ||| |  |||| | || | |          | |||||  || | |    || ||| |||  | |         | ||||    | | | |  |  | | ||              ^***     | || || |     | | | ||         ||   |  | |     |  | | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              ||          ^** | ||||   || | |    |  | |                   ||||| | ||| ^**  || ^**   ^**      ||   | |||||   | ||^**  |||^** || | |          | |||||  || | |    || ||| |||  | |         | ||||    | | ^**  |  | | ||                       | || || |     | | | ||         ||   |  | |     |  | ^**     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              ||              | ||||   ^*** |    |  | |                   ||||| ^***| |    || | |            ||   | |||||   ^***|    |||| | || | |          | |||||  ^*** |    || ||| ||^*** |         | ||||    | | |    |  | | ||                       | ^***| |     | | | ||         ||   |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              ||              | ||||    | | |    ^*****                   |||||   | | |    || | |            ||   | |||||   | | |    |||| | || | |          | |||||   | | |    || ||| ||   | |         | ||||    | | |    |  | | ||                       |  ^*****     | | | ||         ||   |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..              ||              | ||||    | | |       | |                   ||||*************** | |            ||   | ||||***************|| | || | |          | ||||*************** ||| ||   | |         | ||||    | | |    |  | | ||                       *************** | | ||         ||   |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              ||              | ||||    | | |       | |                   ||||    | | |    |  | |            ||   | ||||    | | |    | || | || | |          | ||||    | | |    *****| ||   | |         | ||||    | | |    |  | | ||                             | |       | | ||         ||   |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..              ||              | ***|    | | |       ***                   ***|    | ***    |  | |            ||   | ||||    | ***    ***| | || | |          | ***|    | ***    |  | | ||   ***         | ***|    | | |    |  | | ||                             | |       | | ||         ||   |  | |     |  ***       
search RasMol script viewer Motif-ligand binding stats  betabulge ..              **              | ||||    | | |       | |                   ||||    | | |    |  | |            **   | ||||    | | |       | | ** | |          | ||||    | | |    |  | | **               | ||||    | | |    |  | | **                             | |       | | **         **   |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                              | ||||    | | |       | |                   ||||    | | |    ******                 | ||||    | | |       | |    | |          | ||||    | | |    ******                  | ||||    | | |    ******                                | |       | |                 |  | |     |  | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              ****||    | | |       | |                   ||||    | | |       | |                 ****||    | | |       | |    | |          ****||    | | |       | |                  ****||    | | |       | |                                | |       | |                 |  | |     **** |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                ||||    | | |       | |                   ||||    | | |       | |                   ||||    | | |       | |    ***            ||||    | | |       | |                    ||||    *** |       | |                                | |       | |                 |  ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                                ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***                    ****      ***       ***                                ***       ***                 |  |          ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                        | |                                       | |         | |                           | |         | |                           | |         | |                                                                                     | |                 ****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                                       ***         ***                           ***         ***                           ***         ***                                                                                     ***                                         

chain B : HISTONE H3
sec str:  .......
sequence :  ..ARTKQ
seq num:  ..1    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | 
search RasMol script viewer Motif-ligand binding stats  niche ..**** 

   New search    2g9a:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML