triangle PDBeMotif: 2g3r  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell cycle/transcription    | release date: Mon, Feb 20, 2006
Title crystal structure of 53bp1 tandem tudor domains at 1.2 a res
Authors G.MER, J.LEE, J.R.THOMPSON, M.V.BOTUYAN
Method X-RAY DIFFRACTION (resolution: 1.25Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
JMol viewer RasMol script viewer  SO4 201A  ..                                                                          *                  *                         
sec str:  .......eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeeeeeeeee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..1485      1495      1505      1515      1525      1535      1545      1555      1565      1575      1585      1595     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |     |  | |  | |          |  | |||    || ||      |  |     | |||   |    |**^* |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |     |  | |  ^**          |  | |||    || ||      |  |     | |||   |    | ||  |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |     |  | |               |  | |||    || ||      |  |     ^***|   |    | ||  |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |     |  | |               *******^    || ||      |  |       | |   |    | *******^           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |     |  | |                  | |||    || ||      |  |       | |   ^*****  |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |     |  | |                  | ***    || ||      |  |       | |           |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  |     ******                  | |||    || ||      |  |       | |           |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        | |                  ****|    ****|      |  |       | |           ****              ****|      **** |  |  
search RasMol script viewer Motif-ligand binding stats  nest .. |  |        ***                    ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                       ****      ****                                        ****           ****  

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
member of: CATH:search2.30.30.140/search2.30.30.30GENE3D:searchG3DSA_2.30.30.140/searchG3DSA_2.30.30.30PANTHER:searchPTHR15321PFAM:searchPF09038SUPERFAMILY:searchSSF63748UniProt:searchQ12888
JMol viewer RasMol script viewer  SO4 201A  ..                                                                          *   ****           *                         
sec str:  .......eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeeee.....eeeeeeeeeeee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh..
sequence :  ..SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
seq num:  ..1485      1495      1505      1515      1525      1535      1545      1555      1565      1575      1585      1595     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |     |  | |  | |          |  | |||    || ||      |  |     | |||   |    |**^* |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |     |  | |  ^**          |  | |||    || ||      |  |     | |||   |    | ||  |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |     |  | |               |  | |||    || ||      |  |     ^***|   |    | ||  |  |           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |     |  | |               *******^    || ||      |  |       | |   |    | *******^           || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |     |  | |                  | |||    || ||      |  |       | |   ^*****  |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |     |  | |                  | ***    || ||      |  |       | |           |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  |     ******                  | |||    || ||      |  |       | |           |  |              || ||      |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        | |                  ****|    ****|      |  |       | |           ****              ****|      **** |  |  
search RasMol script viewer Motif-ligand binding stats  nest .. |  |        ***                    ***     |  |      |  |       ***                              |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                       ****      ****                                        ****           ****  

   New search    2g3r:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors