triangle PDBeMotif: 2g33  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification virus    | release date: Fri, Feb 17, 2006
Title human hepatitis b virus t=4 capsid, strain adyw
Authors A.ZLOTNICK, C.R.BOURNE
Method X-RAY DIFFRACTION (resolution: 3.96Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains C,D,B,A sequence:
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : CORE ANTIGEN
member of: CATH:search1.10.4090.10PFAM:searchPF00906SUPERFAMILY:searchSSF47852UniProt:searchP03147
sec str:  .......hhhhh.hhhhhh........hhhhhhhhhhh.hhhhhh.....hhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...................
sequence :  ..MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |        || |||  |  ^**|    |  ||| || | |  |   |     |  || || | |   |  |                           ||  |    || ||   |  |  | |  |        |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |        || |||  |  ^***    |  ||| || | |  |   |     |  || || | |   ^***                           ||  |    ^***|   |  |  | |  |        ^***  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |        || |||  |          *****| || | |  |   |     ******** | |                                  ||  |     |  |   |  |  | |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***        || |||  |          |  | | || | |  |   |     |  |  || | |                                  ||  |     |  |   |  |  | |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..              *********          **** **** | |  |   |     ********** |                                  |****     ****   ******* |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                     ******  |   |            |   |                                  |   |               **** ****              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           | |  *****            *****                                  *****                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           ***                                                                                                     

chain D : CORE ANTIGEN
member of: CATH:search1.10.4090.10PFAM:searchPF00906SUPERFAMILY:searchSSF47852UniProt:searchP03147
sec str:  .......hhhhh...............hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh...hhhhh............hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.............
sequence :  ..MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPET
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |   |  |         ^**|            | | |  |   |        || |||||    |  |      |  |       |  ||     ||  || | |||||  |  ||  | |  |        |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |   |  |         ^***            | | |  |   |        || |||||    ^***      |  |       |  ||     ||  || | ^***|  |  ||  | |  |        ^*** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |   |  |                         | | |  |   |        ********              |  |       *****     |***** *****||  |  ||  | |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****   ****                         | | |  |   |        *******               ****       ****      |****  *******  |  ||  | ****             
search RasMol script viewer Motif-ligand binding stats  niche ..                                         *****  |   |         |   |                                     |   |       |   |  |**** ****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                *****         *****                                     *****       *****  *****                  

chain B : CORE ANTIGEN
member of: CATH:search1.10.4090.10PFAM:searchPF00906SUPERFAMILY:searchSSF47852UniProt:searchP03147
sec str:  .......hhhhh....hhhhh......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh...hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh....................
sequence :  ..MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || |  | | |  |  ||  |  ^**||  ||  ||| || | |  |   |        |  || | ||| |  |                           |   |  | || ||      |  ||| ||| |     |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| || |  | | |  |  ||  |  ^***|  ||  ||| || | |  |   |        |  || | ||| ^***                           |   |  | ^***|      |  ||| ||| |     ^***  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| || |  | | |  |  ||  |  |  ||  |*****| || | |  |   |        ***** *****                                |   |  |  |  |      |  ||| ||| |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |***  | | |  |  ||  |  |  ||  ||  | | || | |  |   |        |  || | ||                                 |   |  |  |  |      |  ||| ||| |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |  **** | ***********  |  ||  |**** **** | |  |   |        ****| ****                                 |   |  *******      |  |****|| |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***     | |    |  |      |  ||  |       |  | |  |   |            |   |                                  |   |               |  | |  || |           
search RasMol script viewer Motif-ligand binding stats  nest ..        ***    |  |      |  ||  |       |  | |  |   |            |   |                                  |   |               |  | |  || |           
search RasMol script viewer Motif-ligand binding stats  niche ..               ****      |  ||  |       ******  |   |            |   |                                  |   |               **** *******           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         *****  |          | |  |   |            |   |                                  |   |                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            *****          | |  *****            *****                                  *****                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           ***                                                                                                     

chain A : CORE ANTIGEN
member of: CATH:search1.10.4090.10PFAM:searchPF00906SUPERFAMILY:searchSSF47852UniProt:searchP03147
sec str:  .......hhhhh.hhhhhh........hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh...............
sequence :  ..MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  | ||  |       ^**||  || |||| |||| |  |   |        |  || ||||| || |   |  || ||                |   |  | || ||  |  ||  ||| ||        || |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  | ||  |       ^***|  || |||| |||| |  |   |        |  || ||||| ^***   |  || ||                |   |  | ^***|  |  ||  ||| ||        ^***   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  | ||  |       *****  |**********| |  |   |        **************     |  || ||                |   |  |  |  |  *****  |*****         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****  | |****       *****  ********** | |  |   |        *************      ********                |   |  *******  ****   |****|         | |   
search RasMol script viewer Motif-ligand binding stats  niche ..           | |                             ***  |   |            |   |   |                              |   |              |   | ****         ***   
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                             | |  *****            *********                              *****              *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                             ***                                                                                                      

   New search    2g33:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors