triangle PDBeMotif: 2g1o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.23.15
Classification hydrolase    | release date: Tue, Feb 14, 2006
Title ketopiperazine-based renin inhibitors: optimization of the "
Authors D.D.HOLSWORTH, E.ZHANGA
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search 2IG 2IG binding statistics 2IG
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGT
VSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSE
NSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALG
AKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEF
DRRNNRIGFALAR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 885A  ..          ***               * * *                                          ***                                ** ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 985A  ..          |||               | | |                                  *       |||                                || || |  |                                                                                                  ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhh.eeeeeeeee.......eeeeeeeee..........eeee.......eeehhhhhhhhhhhhh.ee....eeee.hhh.....eeeee...eeeehhhhhh.........eee..eee..........eeehhhhhh.eeeeee....eeeeeee.
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  ||||    | | ||| ||| ||||    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  ||||    | ^**|| ||| ||||    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |||   | |  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  ^***  || |||         || || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |^***** |  ^*****         ^*****           || || |    | | |  |           | ||||              | |           || ||          |  |      ^*****          |  ||||    ^*****   || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** | ||| ||| ||||    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                      ***^********        || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  ||||      | ||| ||*****|    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ||||             || |||         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***|      | ||| ||| || |    |  |  |  ***     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ***|             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || |      | ||| ||| || |    |  |  |          |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         || |             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || |      | ||| |***** |    |  |  |          |                                  ***** |    | | ****           ****||              | |           ****|          |  |                         || |             |****|         *****  |              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ||||              ***            |  |          |  |                         || |             |  | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ****                             |  |          |  |                         || |             |  ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****      ********  ****    *******          |                                   ******    *** ****              ***                             ****          ****                         ****             |    |             ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                              || |      | | | |                            |                                                                                                                                              ||               ******                                        | | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |      *** ***                            |                                                                                                                                              ||                                                             *****                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 886B  ..          ***               * * *                                          * *                                *  ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 986B  ..          |||               | | |                                 ** *     | |                     *          |  || |  |           *                                                                                      ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhhh...hhhhh........eeeee....eeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhhhh....eeee.......eeeeeeeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhee........eeee.eee..........eeehhhhhhheeeeee....eeeeee..
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  |||| |  | | ||| |   |  |    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  |||| |  | ^**|| |   |  |    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |||   | |  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || ^***     | |         |  || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |^***** |  ^*****         ^*****           || || |    | | |  |        |   ||||| | |                         |  |          |  |      ^*****    | |   |  ||||    ^*****      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |   ***^********|   |      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  |||| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ||||     |   |      | |         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ***|     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || | |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || | |    |  || |   |  |    |  | ||  | |     |                                  ****| |    | | ****        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         ********              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   ||||| ***                         |  |          |  |                | |      || |     |   |      | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   |****                             |  |          |  |                ***      || |     |   |      ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              || ***    ****| |   ****    *******  ***     |                                   ******    *** ****        |   | ***                             ****          ****                         ****     |   |                      ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              || |          | |              | |           |                                                             |   |                                                                            ||       *****                                                   | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              || |          | |              | |           |                                                             *****                                                                            ||                                                               | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |          ***              ***           |                                                                                                                                              ||                                                               ***                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 885A  ..          ***               * * *                                          ***                                ** ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 985A  ..          |||               | | |                                  *       |||                                || || |  |                                                                                                  ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhh.eeeeeeeee.......eeeeeeeee..........eeee.......eeehhhhhhhhhhhhh.ee....eeee.hhh.....eeeee...eeeehhhhhh.........eee..eee..........eeehhhhhh.eeeeee....eeeeeee.
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  ||||    | | ||| ||| ||||    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  ||||    | ^**|| ||| ||||    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |||   | |  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  ^***  || |||         || || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |^***** |  ^*****         ^*****           || || |    | | |  |           | ||||              | |           || ||          |  |      ^*****          |  ||||    ^*****   || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** | ||| ||| ||||    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                      ***^********        || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  ||||      | ||| ||*****|    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ||||             || |||         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***|      | ||| ||| || |    |  |  |  ***     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ***|             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || |      | ||| ||| || |    |  |  |          |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         || |             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || |      | ||| |***** |    |  |  |          |                                  ***** |    | | ****           ****||              | |           ****|          |  |                         || |             |****|         *****  |              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ||||              ***            |  |          |  |                         || |             |  | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ****                             |  |          |  |                         || |             |  ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****      ********  ****    *******          |                                   ******    *** ****              ***                             ****          ****                         ****             |    |             ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                              || |      | | | |                            |                                                                                                                                              ||               ******                                        | | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |      *** ***                            |                                                                                                                                              ||                                                             *****                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

chain B : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 886B  ..          ***               * * *                                          * *                                *  ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 986B  ..          |||               | | |                                 ****     | |                     *          |  || |  |           *                                                                                      ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhhh...hhhhh........eeeee....eeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhhhh....eeee.......eeeeeeeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhee........eeee.eee..........eeehhhhhhheeeeee....eeeeee..
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  |||| |  | | ||| |   |  |    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  |||| |  | ^**|| |   |  |    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |||   | |  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || ^***     | |         |  || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |^***** |  ^*****         ^*****           || || |    | | |  |        |   ||||| | |                         |  |          |  |      ^*****    | |   |  ||||    ^*****      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |   ***^********|   |      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  |||| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ||||     |   |      | |         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ***|     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || | |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || | |    |  || |   |  |    |  | ||  | |     |                                  ****| |    | | ****        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         ********              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   ||||| ***                         |  |          |  |                | |      || |     |   |      | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   |****                             |  |          |  |                ***      || |     |   |      ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              || ***    ****| |   ****    *******  ***     |                                   ******    *** ****        |   | ***                             ****          ****                         ****     |   |                      ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              || |          | |              | |           |                                                             |   |                                                                            ||       *****                                                   | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              || |          | |              | |           |                                                             *****                                                                            ||                                                               | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |          ***              ***           |                                                                                                                                              ||                                                               ***                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 886B  ..          ***               * * *                                          * *                                *  ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 986B  ..          |||               | | |                                 ****     | |                     *          |  || |  |           *                                                                                      ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhhh...hhhhh........eeeee....eeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhhhh....eeee.......eeeeeeeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhee........eeee.eee..........eeehhhhhhheeeeee....eeeeee..
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  |||| |  | | ||| |   |  |    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  |||| |  | ^**|| |   |  |    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || | ||     | |         |  || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |||   | |  |    |         |    |           || || |    | | |  |        |   ||||| | |                         |  |          |  |      |    |    | |   |  ||||    || ^***     | |         |  || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  |||| |  | |  || |   |  |    |  | ||  |^***** |  ^*****         ^*****           || || |    | | |  |        |   ||||| | |                         |  |          |  |      ^*****    | |   |  ||||    ^*****      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |   ***^********|   |      | |         |  ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  |||| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ||||     |   |      | |         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***| |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      ***|     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || | |    |  || |   |  |    |  | ||  | |     |                                  || || |    | | |  |        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         |  ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || | |    |  || |   |  |    |  | ||  | |     |                                  ****| |    | | ****        |   ||||| | |                         |  |          |  |                | |      || |     |   |      | |         ********              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   ||||| ***                         |  |          |  |                | |      || |     |   |      | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || | |    |  || |   |  |    |  | ||  | |     |                                   |  | |    | | |  |        |   |****                             |  |          |  |                ***      || |     |   |      ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              || ***    ****| |   ****    *******  ***     |                                   ******    *** ****        |   | ***                             ****          ****                         ****     |   |                      ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              || |          | |              | |           |                                                             |   |                                                                            ||       *****                                                   | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              || |          | |              | |           |                                                             *****                                                                            ||                                                               | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |          ***              ***           |                                                                                                                                              ||                                                               ***                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  2IG 885A  ..          ***               * * *                                          ***                                ** ** *  *                                                                                                  *** *                                                                                                              
JMol viewer RasMol script viewer  NAG 985A  ..          |||               | | |                                  *       |||                                || || |  |                                                                                                  ||| |                                                                                                              
sec str:  ...eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhh.eeeeeeeee.......eeeeeeeee..........eeee.......eeehhhhhhhhhhhhh.ee....eeee.hhh.....eeeee...eeeehhhhhh.........eee..eee..........eeehhhhhh.eeeeee....eeeeeee.
sequence :  ..SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||            | ||  ||||    | | ||| ||| ||||    |  | ||| ^*** ||||  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | | ||                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||            ^**|  ||||    | ^**|| ||| ||||    |  | ^** |||  ^**|  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  | ||  || |||         || || || |            | ||||   | ^**|                         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |||   | |  |    |         |    |           || || |    | | |  |           | ||||              | |           || ||          |  |      |    |          |  ||||    |  ^***  || |||         || || ^***            ^***||   | | ||                         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||               |  ||||    | | ||| ||| ||||    |  |  |  |^***** |  ^*****         ^*****           || || |    | | |  |           | ||||              | |           || ||          |  |      ^*****          |  ||||    ^*****   || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..       | |||               ***^******** | ||| ||| ||||    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                      ***^********        || |||         || ||  |              | ||||   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||                  ||||      | ||| ||*****|    |  |  |  | |     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ||||             || |||         *****  |              *****|   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||                  ***|      | ||| ||| || |    |  |  |  ***     |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         ***|             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****                  || |      | ||| ||| || |    |  |  |          |                                  || || |    | | |  |           | ||||              | |           || ||          |  |                         || |             || |||         || ||  |              | || |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|                  || |      | ||| |***** |    |  |  |          |                                  ***** |    | | ****           ****||              | |           ****|          |  |                         || |             |****|         *****  |              **** |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ||||              ***            |  |          |  |                         || |             |  | |             |  |                |  |   | | ||                         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..         ***                  || |      | ||| ||  |  |    |  |  |          |                                   |  | |    | | |  |             ****                             |  |          |  |                         || |             |  ***             |  |                |  |   | | ||                         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****      ********  ****    *******          |                                   ******    *** ****              ***                             ****          ****                         ****             |    |             ****                ****   ******                         ****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                              || |      | | | |                            |                                                                                                                                              ||               ******                                        | | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                              || |      *** ***                            |                                                                                                                                              ||                                                             *****                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                              ** *                                         *                                                                                                                                              **                                                                                                                 

   New search    2g1o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors