triangle PDBeMotif: 2fyt  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.1.1.
Classification transferase    | release date: Wed, Feb 8, 2006
Title human hmt1 hnrnp methyltransferase-like 3 (s. cerevisiae) pr
Authors A.BOCHKAREV, A.M, A.N.PLOTNIKOV, C.H.ARROWSMITH, H.WU, H.ZENG, J.R.MIN, M.SUNDSTROM, P.LOPPNAU, STRUCTURAL GENOMICS CONSORTIUM (S
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search SAH SAH binding statistics SAH
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN ARGININE N-METHYLTRANSFERASE 3
member of: CATH:search2.70.160.11/search3.40.50.150GENE3D:searchG3DSA_2.70.160.11/searchG3DSA_3.40.50.150PANTHER:searchPTHR11006/searchPTHR11006_SF45PFAM:searchPF06325PROSITE PROFILES:searchPS51678, SUPERFAMILY:searchSSF53335UniProt:searchO60678
JMol viewer RasMol script viewer  SAH 549A  ..   *     *  *     *                       ***  **               ***                       ****              *          *  *                                                                                                                                                                                            
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.....eeeee............eeeeee..........hhhhhhhhhhhhheeeeeeee..eeeeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhh...eee..hhhhh....eeeeeee....hhhhhheeeeeeee....eeeeeeeeeeeeee.......eeee...........eeeeeeeeeeee....eeeeeeeeee.......eeeeeee..eeeeeee.
sequence :  ..FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
seq num:  ..238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||      |  | |   | ||     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| | ||      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| || || |     | |                  |  | |    | |  | || |           | |  |          |  |  |       ^***      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||      |  | |   ^**|     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| | ||      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| || || |     ^**                  |  | |    | |  ^**| |           ^**  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||      |  | |   ^***     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| ^***      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| |^*** |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*** ||      |  | |   |        || || |     ^*****|      | |    ^*****           ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || ||      |  | |   |        ***** |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    *****  |      || ||      ||  ||| |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||      |  | |   |        || || |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      ||  *** |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betabulge .. || ||      |  | |   |        || || |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      **   |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|      |  | |   |        *******     | |||||      | |      | |            ||||  |     ****|            | |  ||**** |       |  ||  |                         |  |****    ****|  |      ****|           |  |  |  |                          **** |    | |  |  | |             |  |          |  ****                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |      |  | |   |         | || |     | |||||      | |      | |            ||||  |      |  |            | |  ***| | |       |  ||  |                         |  |            |  |       |  |           |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |      |  | |   |         | || |     *******      ***      | |            ****  |      |  |            | |   | | ***       |  ||  |                         |  |            |  |       |  |           |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****      **** |   |         ******                           ***               ****      ****            ***   ***           ********                         ****            ****       ****           ****  ****                          ******    ******  | |             ****          *******                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                                                                                                                           | |                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                 ***                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN ARGININE N-METHYLTRANSFERASE 3
member of: CATH:search2.70.160.11/search3.40.50.150GENE3D:searchG3DSA_2.70.160.11/searchG3DSA_3.40.50.150PANTHER:searchPTHR11006/searchPTHR11006_SF45PFAM:searchPF06325PROSITE PROFILES:searchPS51678, SUPERFAMILY:searchSSF53335UniProt:searchO60678
JMol viewer RasMol script viewer  SAH 549A  ..   *        *     *                       ***  **               ***                        ***              *          *  *                                                                                                                                                                                            
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.....eeeee............eeeeee..........hhhhhhhhhhhhheeeeeeee..eeeeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhh...eee..hhhhh....eeeeeee....hhhhhheeeeeeee....eeeeeeeeeeeeee.......eeee...........eeeeeeeeeeee....eeeeeeeeee.......eeeeeee..eeeeeee.
sequence :  ..FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
seq num:  ..238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||      |  | |   | ||     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| | ||      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| || || |     | |                  |  | |    | |  | || |           | |  |          |  |  |       ^***      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||      |  | |   ^**|     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| | ||      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| || || |     ^**                  |  | |    | |  ^**| |           ^**  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||      |  | |   ^***     || || |     | |||||      | |    | | ||           ||||  |     || ||            | |  |||| ^***      |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| |^*** |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*** ||      |  | |   |        || || |     ^*****|      | |    ^*****           ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      ||  ||| |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || ||      |  | |   |        ***** |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    *****  |      || ||      ||  ||| |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||      |  | |   |        || || |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      ||  *** |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betabulge .. || ||      |  | |   |        || || |     | |||||      | |      | |            ||||  |     || ||            | |  |||| | |       |  ||  |                         |  ||  |    |  ||  |      || ||      **   |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|      |  | |   |        *******     | |||||      | |      | |            ||||  |     ****|            | |  ||**** |       |  ||  |                         |  |****    ****|  |      ****|           |  |  |  |                          **** |    | |  |  | |             |  |          |  ****                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |      |  | |   |         | || |     | |||||      | |      | |            ||||  |      |  |            | |  ***| | |       |  ||  |                         |  |            |  |       |  |           |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |      |  | |   |         | || |     *******      ***      | |            ****  |      |  |            | |   | | ***       |  ||  |                         |  |            |  |       |  |           |  |  |  |                          |  | |    | |  |  | |             |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****      **** |   |         ******                           ***               ****      ****            ***   ***           ********                         ****            ****       ****           ****  ****                          ******    ******  | |             ****          *******                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                                                                                                                                           | |                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                 ***                                                   

   New search    2fyt:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors