triangle PDBeMotif: 2fol  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Fri, Jan 13, 2006
Title crystal structure of human rab1a in complex with gdp
Authors A.BOCHKAREV, A.EDWARDS, C.ARROWSMITH, H.PARK, J.WANG, J.WEIGELT, L.SHEN, M.SUNDS, STRUCTURAL GENOMICS CONSORTIUM, W.TEMPEL, Y.SHEN
Method X-RAY DIFFRACTION (resolution: 2.63Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP   search UNX UNX binding statistics UNX
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWD
TAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSL
GIPFLETSAKNATNVEQSFMTMAAEIKKRMG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAS-RELATED PROTEIN RAB-1A
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF419PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP62820
JMol viewer RasMol script viewer  UNX 402A  ..                                                           ..                                                                                                
JMol viewer RasMol script viewer  UNX 401A  ..                                                           ..                                                                                                
JMol viewer RasMol script viewer  GDP 201A  ..           ********         * *                            ..                                           ** **                         ***                    
JMol viewer RasMol script viewer  MG 202A  ..           ||||||*|         | |                            ..                                           || ||                         |||                    
sec str:  ....eeeeeeeee....hhhhhhhhhhhh..............eeeeeee..eeeeeeee........eeeeeee..hhhhhhhhhhhhhhhhhh.....eeeeeee..........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh
sequence :  ..YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWD..YRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
seq num:  ..5         15        25        35        45        55       ..78        88        98        108       118       128       138       148       158       168   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |   |   |  |||||||  |  | |||||   ||||        |  || |     ..|  |       | || |                |  |       | | | || |   | || || |||     | |^*** ||   |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   |   |  |||||||  |  | |||||   ||||        |  |^**     ..|  |       | || |                |  |       | | ^**| |   ^**| || |||     ^**| || ||   |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   |   |  |||||||  |  | ^***|   ||||        |  |        ..|  |       | ^***                |  |       | | |  | |   ^*** || |||        | ^***|   |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..**^   |   |  |||||||  ******^| |   ||||        |  |        ..|  |       |  |                  |  |       | | |  | |        || |||        | || ||   |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |   |  ^*****|     | | | |   ||||        |  |        ..|  |       |  |                  |  |       | | |  | |        || |||        | || ||   |         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      |   ******** |     | | | |   ||||        |  |        ..|  |       |  |                  |  |       | | |  | |        || |||        | || ||   |         
search RasMol script viewer Motif-ligand binding stats  SIGMA54_INTERACT_1 ..      **************     | | | |   ||||        |  |        ..|  |       |  |                  |  |       | | |  | |        || |||        | || ||   |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |||||       | | | |   ||||        ****        ..|  |       ****                  |  |       | | |  | |        |****|        | || ||   |         
search RasMol script viewer Motif-ligand binding stats  nest ..             *****       *** | |   |***                    ..|  |       |  |                  |  |       *** |  | |        |  ***        ******|   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                             ***   | |                     ..****       ****                  ****           ******        |    |              |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                   | |                     ..                                                              ******              |   |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   | |                     ..                                                                                  *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                   ***                     ..                                                                                                

   New search    2fol:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors