triangle PDBeMotif: 2fg5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Wed, Dec 21, 2005
Title crystal structure of human rab31 in complex with a gtp analogue
Authors (SGC), A.BOCHKAREV, A.EDWARDS, C.ARROWSMITH, H.PARK, J.WANG, J.WEIGELT, M.SUNDSTROM, S.ISMAIL, STRUCTURAL GENOMICS CONSORTIUM, W.TEMPEL
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GNP GNP binding statistics GNP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTA
GQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGA
IVVETSAKNAINIEELFQGISRQIPPLDPHEN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAS-RELATED PROTEIN RAB-31
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF331PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchQ13636
JMol viewer RasMol script viewer  GNP 302A  ..           *******         *** * **                         *                                                      ** **                         ***                 
JMol viewer RasMol script viewer  MG 301A  ..           |||||*|         ||| | |*                         |                                                      || ||                         |||                 
sec str:  ...eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeee....eeeeeeeee..hhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhh..hhhhhhhhhhh...eeee.......hhhhhhhhhhhh..
sequence :  ..IRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIP
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  ||||||      | | |  |                           | |  |  |  | ||||   |   | |||| ||^**      |  |           | |||  |             | |     ^**| || |      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  ||||||      | | |  |                           | |  |  |  | ||||   |   | ^*** |||        |  |           | |||  |             | |        | || |      |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ^*****      | | |  |                           | |  |  |  | ||^*****   |  ||| |||        |  |           | |||  |             | |        | || |      |  | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         ********       | | |  |                           | |  |  |  | || |       |  ||| |||        |  |           | |||  |             | |        | || |      |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||       | | |  |                           | |  |  |  | || |       |  |*****|        |  |           | |||  |             | |        | || |      |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||       | | |  |                           | *******  | || |       |  |**** |        |  |           ********             | |        | || |      |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..            *****       *** |  |                           | |        | || |       |  | |   |        |  |           *** |  |             ***        ******      |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                            ****                           ***        ******       **** |   |        ****               ****                                    **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                        *****                                                                        

   New search    2fg5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors