triangle PDBeMotif: 2fc8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification rna binding protein    | release date: Mon, Dec 12, 2005
Title solution structure of the rrm_1 domain of ncl protein
Authors (RSGI), M.INOUE, M.SHIROUZU, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, S.YOKOYAMA, T.KIGAWA, T.TERADA, W.DANG, Y.MUTO
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEID
GNKVTLDWAKPKGEGGSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**||  |^** |  ^**|||^** |      |  | |  |  |  | | ||   | | |     |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***|  |    |  ^***||| | |      ^*** |  |  |  | | ||   | | |     |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | ||||| |  ^*****      |^*****           |  |  |  | | ^***** | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** ***** |              | | | |           ****  **** ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |  |  ||  |   |   |              | | | |                 |  |          ***            
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |  |  |  | |  |  ||  | ||^**| | |^** |  ^**|||^** |      |  | |  || || | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |  |  |  | |  |  ||  ^***^*** | |    |  ^***||| | |      ^*** |  || || | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****  |  |  | |  |  ||  | || ||  | ^*****   | ||^*****           |  || || | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |  |  | |  |  ||  | || ||  | |        ***| | | |           |  || || | |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |  | |  |  |**** *****  | |           | | | |           ********** ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |  | |  |  ||  |        ***           | | | |                 |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |  | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  ***  ********                                              ****                         

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |  |  |  | |  |  ||  |  |^**||  |^** |  ^**|||^** |      | || || || |  | | ||   |         | |  | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |  |  |  | |  |  ||  ^***^***|  |    |  ^***||| | |      ^*** || || |  | | ||   |         | |  | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****  |  |  | |  |  ||  |  || | |  ^*****   | ||^*****        |  || || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  |  | |  |  ||  |  || | |           | || | | |        ******** |  | |  |             | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |  |  | |  |  ||  |  || | |           ***| | | |        |  |  |  |  | |  |             | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |  | |  |  |****  **** |              | | | |        *******  **** ****             | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |  | |  |  ||  |   |   |              | | | |                 |  |                  ***    
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |  | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    | | |  | | |  |  ||  |  |^**| | |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    | | |  | | |  |  ||  ^***^*** | |    |  ^***||| | |      ^*** |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^***** | |  | | |  |  ||  |  |  |  | ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | | |  |  |****  ****  | |           | | | |           ****  **** ****               | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***  | | |  |  ||  |        ***           | | | |                 |  |                    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | | |  |  ||  |                      *** ***                 |  |                    | |  
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ***  ********                      | |                     ****                    ***  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ***                                                  

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    || |||   | |  |  ||  | ||^**||| |^** |  ^**|||^** |      | || |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    || |||   | |  |  ||  ^***^***|| ||   |  ^***|||   |      ^*** |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****| |||   | |  |  ||  | | ||  || ^*****      |^*****        |  |  || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |||   | |  |  ||  | | ||  ||  |          | |            |  ***** |  | |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|   | |  |  |**** ****  ||  |          | |            *******  **** ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***   | |  |  ||  |   |   ||  |          | |                     |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   ||  |          ***                     |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |****                                  ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**||| |^** |  ^**|||^** |      |  | |  || |  | | ||   |         |  | | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***|| |    |  ^***||| | |      ^*** |  || |  | | ||   |         |  | | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | | |||||| ^*****      |^*****           |  || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |  |  ||  | | ||||||             | | | |           ***** |  | |  |                | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** ********             | | | |           ****  **** ****                | | 
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |  |||             *** ***                 |  |                     | | 
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |  ***                                     ****                     *** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    ||  |    | |  |  ||  | ||^**||| |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    ||  |    | |  |  ||  ^***^***|| |    |  ^***|||   |      ^*** |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****|  |    | |  |  ||  | ||||| || ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |    | |  |  |**** ***** || |           | |               ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |  |  ||  |   |   |***           | |                     |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |  |  ||  |   |   |              ***                     |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |  |  |  | |  |  ||  | ||^**| | |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |  |  |  | |  |  ||  ^***^*** | |    |  ^***|||   |      ^*** |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****  |  |  | |  |  ||  | || ||  | ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |  | |  |  |**** *****  | |           | |               ****  **** ****               | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |  | |  |  ||  |        ***           | |                     |  |                    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |  | |  |  ||  |                      ***                     |  |                    | |  
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  ***  ********                                              ****                    ***  

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    || |  |  | |  |  ||  | ||^**|   |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    || |  |  | |  |  ||  ^***^***   |    |  ^***||| | |      ^*** |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****| |  |  | |  |  ||  | || ||    ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | ****  | |  |  |**** *****                | | | |           ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***     | |  |  ||  |                      | | | |                 |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********                                              ****                         

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  | ||       | |  |  ||  | ||^**||  |^** |  ^**|||^** |      |  | |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  | ||       | |  |  ||  ^***^***|  |    |  ^***|||   |      ^*** |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****|       | |  |  ||  | ||||| |  ^*****      |^*****           |  || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |       | |  |  ||  | ||||| |              | |               ***** |  | |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |       | |  |  |**** ***** |              | |               ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |       | |  |  ||  |   |   |              ***                     |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..   ****       ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**|   |^** |  ^**|||^** |      |  | |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***   |    |  ^***||| | |      ^*** |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | || ||    ^*****      |^*****           |  || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |  |  ||  | || ||                | | | |           ***** |  | |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** *****                | | | |           ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********                                              ****                         

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**|   |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***   |    |  ^***||| | |      ^*** |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | || ||    ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** *****                | | | |           ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********                                              ****                         

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**||  |^** |  ^**|||^** |      |  |       |  | | ||   |     | | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***|  |    |  ^***||| | |      ^***       |  | | ||   |     | | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | ||||| |  ^*****      |^*****                 |  | | ^*****     | | ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** ***** |              | | | |                 **** ****         | |        
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   |              *** ***                 |  |              ***        
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |              | |                     ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****              | |                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ***                                                  

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    || |     | |  |  ||  | ||^**||  |^** |  ^**|||^** |      |  |       |  | | ||   |       | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    || |     | |  |  ||  ^***^***|  |    |  ^***|||   |      ^***       |  | | ||   |       | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****| |     | |  |  ||  | ||||| |  ^*****      |^*****                 |  | | ^*****       | ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |     | |  |  |**** ***** |              | |                     **** ****           | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***     | |  |  ||  |   |   |              | |                     |  |                ***      
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   |              ***                     |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  |  |^**||  |^** |  ^**|||^** |      | || |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***|  |    |  ^***||| | |      ^*** |  || |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  |  || | |  ^*****      |^*****        |  |  || |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |  |  ||  |  || | |              | | | |        |  ***** |  | |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |****  **** |              | | | |        *******  **** ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  | |        | |  |  ||  | ||^**||| |^** |  ^**|||^** |      |  | |  |  |  | | ||   |       | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  | |        | |  |  ||  ^***^***|| |    |  ^***||| | |      ^*** |  |  |  | | ||   |       | |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | ||||| || ^*****      |^*****           |  |  |  | | ^*****       | ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |        | |  |  |**** ***** || |           | | | |           ****  **** ****           | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |        | |  |  ||  |   |   |***           | | | |                 |  |                ***      
search RasMol script viewer Motif-ligand binding stats  nest ..   | |        | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..   ***        ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    ||  |    | |  |  ||  | ||^**|   |^** |  ^**|||^** |      |  | |  |  |  | | ||   |    | |  |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    ||  |    | |  |  ||  ^***^***   |    |  ^***||| | |      ^*** |  |  |  | | ||   |    | |  |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****|  |    | |  |  ||  | || ||    ^*****   | ||^*****           |  |  |  | | ^*****    | |  ^***** 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |    | |  |  ||  | || ||             ***| | | |           |  |  |  | |  |        | |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |    | |  |  |**** *****                | | | |           ****  **** ****        | |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |  |  ||  |                      | | | |                 |  |             ***         
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    ***  ********                                              ****                         

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    | | |    | |  |  ||  |  |^**||| |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    | | |    | |  |  ||  ^***^***|| |    |  ^***||| | |      ^*** |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^***** | |    | |  |  ||  |  || | || ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |    | |  |  |****  *******             | | | |           ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***    | |  |  ||  |   |   |              | | | |                 |  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |        | |  |  ||  | ||^**|   |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |        | |  |  ||  ^***^***   |    |  ^***||| | |      ^*** |  |  |  | | ||   |         | | || 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****        | |  |  ||  | || |||   ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |  |  ||  | |*****               | | | |           |  |  |  | |  |               | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |  |  |**** *****                | | | |           ****  **** ****               | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |  |  ||  |                      | | | |                 |  |                    ***  
search RasMol script viewer Motif-ligand binding stats  nest ..              | |  |  ||  |                      *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..              ***  ********                                              ****                         

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NCL PROTEIN
sec str:  ...................eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee..............
sequence :  ..GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|    |  | |   | |  |  ||  | ||^**||  |^** |  ^**|||^** |      |  | |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|    |  | |   | |  |  ||  ^***^***|  |    |  ^***||| | |      ^*** |  |  |  | | ||   |         |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****  | |   | |  |  ||  | | ||  |  ^*****      |^*****           |  |  |  | | ^*****         ^***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |   | |  |  |**** ****  |              | | | |           ****  **** ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..        | |   | |  |  ||  |   |   |              *** ***                 |  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..        ***   ***  ********   |   |                                      ****                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                                                                   

   New search    2fc8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML