triangle PDBeMotif: 2f5y  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Mon, Nov 28, 2005
Title crystal structure of the pdz domain from human rgs-3
Authors A.EDWARDS, A.TURNBULL, C.ARROWSMITH, C.JOHANSSON, C.SMEE, D.DOYLE, E.PAPAGRIGOR, E.UGOCHUKWU, F.GORREC, F.VON DELFT, G.BERRIDGE, G.BUNKOCZI, J.DEBRECZENI, J.ELKINS, J.WEIGELT, M.SUNDSTROM, N.BURGE, P.SAVITSKY, S.COLEBROOK, STRUCTURAL GENOMICS CONSORT, X.YANG
Method X-RAY DIFFRACTION (resolution: 2.39Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SMRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVW
RMVPQVKPGPD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALLING 3 ISOFORM 1
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR10845/searchPTHR10845_SF4PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchP49796
JMol viewer RasMol script viewer  SO4 2A  ..                                                            *  **  *              
JMol viewer RasMol script viewer  SO4 1A  ..          **                      *  *                      |  ||  |              
sec str:  ...eeeeeeee.......eeee.....eeeee...hhhhhhh.....eeeee..ee....hhhhhhhhhhh...eeeeeeee..
sequence :  ..MRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV
seq num:  ..14        24        34        44        54        64        74        84          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**            | |             |  |    | ||  |  || | |           | | ||            
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |             |  |    | ||  |  ** | |           | | ||            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |             |  |    | |****     | |           | | ||            
search RasMol script viewer Motif-ligand binding stats  nest ..              ***             |  |    ***|  |     | |           | | ||            
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****       ****     ***           | ****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                *****             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : REGULATOR OF G-PROTEIN SIGNALLING 3 ISOFORM 1
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR10845/searchPTHR10845_SF4PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchP49796
sec str:  ...eeeeeeee.......eeee....eeeeee...hhhhhhh.....eeeee..ee....hhhhhhhhhhh...eeeeeeee..
sequence :  ..MRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV
seq num:  ..14        24        34        44        54        64        74        84          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**            | |             |  |    | ||  |  |||  | |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |             |  |    | ||  |  **|  | |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |             |  |    | |****    **** |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..              ***             |  |    ***|  |         |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****       ****         ****        ****            

   New search    2f5y:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors