triangle PDBeMotif: 2eyz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification signaling protein    | release date: Thu, Nov 10, 2005
Title ct10-regulated kinase isoform ii
Authors F.INAGAKI, S.TANAKA, Y.KOBASHIGAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : V-CRK SARCOMA VIRUS CT10 ONCOGENE HOMOLOGISOFORM A;
member of: GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR19969/searchPTHR19969_SF8PFAM:searchPF00017/searchPF00018/searchPF07653PRINTS:searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP46108
sec str:  ......................hhhhhh........ee...........eeee......eeee..................................hhhhhhh.................................eeee..................eeeeee.....eeeee.....eeeee...eee...........................................................................eeeee.....eeeee..eeee...................
sequence :  ..MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |    | |     | || || ||  |||   |        |  |   |  |         ^***|             |    |  |  |    |  |            |  |    |  |     |     |          |  |   |  |        |  |    | ||||    |  |            | ||    |  | |          ||| |                    |  || |              ^***||  ||| ||    | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | |     | |^*** ||  |||   |        ^***   ^***           | |             |    |  |  |    |  |            ^***    |  |     |     |          |  |   |  |        |  |    | ||||    |  |            | ||    |  | |          ||| |                    |  || |                ||||  ||| ||    | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |    | |     | |  |  ||  |||   |                              | |             |    |  |  |    |  |                    |  |     ******^          |  |   |  |        |  |    | ||||    |  |            | ||    |  | |          ||| |                    |  || |                ||||  ||| ||    | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |     | |  |  ||  |^*****                              | |             ^*****  |  |    |  |                    |  |                      |  |   |  |        |  |    | ||||    |  |            | |^*****  | |          ||| |                    |  || |                |^*****|| ||    | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |     | |  |  ||  | |                                  | |                     |  |    |  |                    |  |                      |  |   |  |        |  |    | ^***    |  |            | |        | |          ||| |                    |  || |                ||||   |^***    | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |     | |  *****  | |                                  | |                     |  |    |  |                    |  |                      |  |   |  |        |  |    | |||     |  |            | |        | |          ||| |                    |  || |                ||||   |  |     | ||      | |||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |     | |  |  ||  | |                                  | |                     |  |    |  |                    |  |                      |  |   |  |        |  |    | |||     |  |            | |        | |          ||| |                    |  || |                ||||   |  |     | ||      *****||
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |     | |  |  ||  | |                                  | |                     |  |    |  |                    |  |                      |  |   |  |        |  |    | |||     |  |            | |        | |          ||| |                    |  || |                ||||   |  |     | ||      ***||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |     | |  |  ||  | |                                  | |                     |  |    |  |                    |  |                      |  |   |  |        |  |    *****     |  |            | |        | |          ||| |                    |  || |                ||||   |  |     | ||      |  ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |     | |  ******** |                                  | |                     ****    ****                    ****                      |  |   ****        |  |    ****|     |  |            | |        | |          ||| |                    |  || |                ||||   ****     | ||      ****|||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***     ***         ***                                  | |                                                                               |  |   |  |        |  |      | |     |  |            ***        ***          *** |                    |  || |                |***            | ||         ||||
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                | |                                                                               |  |   |  |        |  |      ***     |  |                                     |  |                    |  || |                ***             ***|         ****
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                                                                               ****   ****        ****              ****                                     ****                    *******                                ****             

   New search    2eyz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML