triangle PDBeMotif: 2eyy  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification signaling protein    | release date: Thu, Nov 10, 2005
Title ct10-regulated kinase isoform i
Authors F.INAGAKI, S.TANAKA, Y.KOBASHIGAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGN
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : V-CRK SARCOMA VIRUS CT10 ONCOGENE HOMOLOGISOFORM A;
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR19969/searchPTHR19969_SF8PFAM:searchPF00017/searchPF00018PRINTS:searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP46108
sec str:  ....................hhhhhhhhhh........eee.......eeeee......eeeeee........................ee......hhhhhhhhh....................hhhhh.....eeee...................eeeeeeeee..eeeee.....eeee......................
sequence :  ..MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGN
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |    |   | |    |  |  ||| |||  |    ||| |  |   || |         ^***              |   |||         | || ||         |  | |||| | | |  | |   |        | |  |   |  |                | ||||        | |    ||||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    |   | |    ^***  ||| |||  |    ||| ^***   ^***                           |   |||         | || ||         ^*** |||| | | |  | |   |        | |  |   |  |                | ||||        | |    ||||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |    |   | |       |  ||| |||  |    ||| |       | |                           |   |||         | || ||              |||| | | |  ******^        | |  |   |  |                | ||||        | |    ||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****   | |       |  ||| ^*****    ||| |       | |                           ^*****|         | || ||              |||| | | |  | |            | |  |   |  |                | ||||        | |    ||||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           | |       |  ||| |||  |    ||| |       | |                               | |         | || ||              |||| | | |  | |            | |  |   |  |                | ^***        | |    ||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |       *****| |||  |    ||| |       | |                               | |         | *****              |||| | | |  | |            | |  |   |  |                | |||         | |    ||||      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | |       |  ||| |||  |    ||| |       | |                               | |         | || |               |||| | | |  | |            | |  |   |  |                *****         | |    ||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |       *************    |****       | |                               | |         ******               |||| | | |  | |            | ****   ****                ****|         | |    ||||      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |                |  |    *** |       ***                               ***                              |||| *** |  | |            | |  |   |  |                  | |         ***    ||||      
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                |  |     |  |                                                                          ****   ***  ***            | |  |   |  |                  ***                ****      
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                ****     ****                                                                                                     ******   ****                                               

   New search    2eyy:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML