triangle PDBeMotif: 2eug  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.3
Classification hydrolase    | release date: Tue, Oct 13, 1998
Title crystal structure of escherichia coli uracil dna glycosylase complexes with uracil and glycerol: structure and glycosyla mechanism revisited
Authors A.C.DROHAT, G.L.GILL, G.XIAO, J.JAGADEESH, J.T.STIVERS, M.TORDOVA
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (GLYCOSYLASE)
member of: CATH:search3.40.470.10GENE3D:searchG3DSA_3.40.470.10HAMAP:searchMF_00148PANTHER:searchPTHR11264/searchPTHR11264_SF4PFAM:searchPF03167PROSITE PATTERNS:searchPS00130, SMART:searchSM00986/searchSM00987SUPERFAMILY:searchSSF52141TIGRFAMS:searchTIGR00628UniProt:searchP12295
sec str:  ....hhhhh..hhh.hhhhhhhhhhhhhhh........hhh..hhhhh..hhh..eeeee........................hhhhhhhhhhhhh............hhhhhh.eeeee.................hhhhhhhhhhhhhhh....eeeee.hhhhhh.........eeeee.......hhh......hhhhhhhhhhhh................
sequence :  ..LTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  || ||           ^**|| |    |  |    |  ||| |||      | | | | |  |  ^**  |           | | ||  |    | |   || |||       ^** || |||      | ^**     |  |  |          | || |||| |      | |  |  |||||||||      || ||||  | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|  || ||           || || |    |  |    |  ||| |||      | | | | |  |  | |  |           | | ||  |    | |   || |||         | || |||      ^***      |  |  |          | || |||| |      | |  |  |||||||||      || |||^*** |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |   |  || ||           || || |    |  |    |  ||| |||      | | | ^*****  | |  |           | | ||  |    | |   || |||         | ^*****                |  |  |          | || |||| |      | |  |  |||||||||      || |||   | |        
search RasMol script viewer Motif-ligand binding stats  U_DNA_GLYCOSYLASE .. |   |  || ||           || || |    |  |    |  ||| ||*******^** | | |  |  | |  |           | | ||  |    | |   || |||         |  | |||                |  |  |          | || |||| |      | |  |  |||||||||      || |||   | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |  || ||           || || |    |  |    |  |*****       | | | | |  |  | |  |           | | ||  |    | |   || |||         |  | |||                |  |  |          | || |||| |      | |  |  |||||||||      || |||   | |        
search RasMol script viewer Motif-ligand binding stats  asxturn .. |   |  || ||           || || |    |  |    |  ||| ||       | | | | |  |  | |  |           | | ||  |    | |   || |||         |  | |||                |  |  |          | || |*** |      | |  |  |||||||||      || |||   | |        
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |  *****           ***** |    ****    |  |****|       | | | | |  |  | ****           | | |****    | |   *****|         *******|                |  |  |          **** | |  |      | |  |  |||||||||      |****|   | |        
search RasMol script viewer Motif-ligand binding stats  nest .. |   |   |  |               ***            |  | |  |       | | | ***  |  | |  |           | | ||  |    | |   |  ***              ***                |  |  |            |  | |  |      | |  |  *********      |  ***   | |        
search RasMol script viewer Motif-ligand binding stats  niche .. |   |   ****                              **** ****       | ***      **** ****           | *******    ***   |    |                                 *******            **** ****      ***  |                 |    |   ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop .. |   |                                                     |                              |   |              ******                                                                   |    |                 ******              
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****                                                     |                              |   |                                                                                       |    |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                           |                              *****                                                                                       ******                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                           *                                                                                                                          *                                          

   New search    2eug:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors