triangle PDBeMotif: 2es0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Tue, Oct 25, 2005
Title structure of the regulator of g-protein signaling domain of
Authors (SGC), A.EDWARDS, A.TURNBULL, C.ARROWSMITH, C.GILEALDI, C.JOHANSSON, C.PHILLIPS, D.A.DOYLE, E.LONGMAN, F.NIESEN, F.SOBOTT, F.VON DELFT, G.A.SCHOCH, J.M.EL, L.BALL, M.SUNDSTROM, STRUCTURAL GENOMICS CONS
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SMPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINL
DSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALLING 6
member of: GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF27PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchP49758
sec str:  ....hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..MPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLL
seq num:  ..324       334       344       354       364       374       384       394       404       414       424       434       444      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        || ||  ||  | |           ||||           |  |                 | ||   |     |   |     ||| ||| |      |   |     |  |  || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        || |^***|  | |           ||||           |  |                 | ||   |     |   |     ||| |^***      |   |     |  |  || || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||   |  | |           ||||           |  |                 | ^*****     |   |     |^*****        |   |     |  |  || || 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        || ||   |  | |           ||||           |  |                 |  |         |   |     | | |          |   |     |  |  || || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        || ||   |  | |           ||||           |  |                 |  |         |   |     | | |          |   |     |  |  ***** 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        || ||   |  ***           ||||           |  |                 |  |         |   |     | | |          |   |     |  |  || |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|   |  |             ||||           |  |                 |  |         |   |     | | |          |   |     ****  ****  
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |   |  |             ****           |  |                 |  |         |   |     *****          |   |     |  |   |    
search RasMol script viewer Motif-ligand binding stats  niche ..         ****   ****                            ****                 ****         |   |                    |   |     ****   |    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                  |   |                    |   |        *****    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                  *****                    *****                 

   New search    2es0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors