triangle PDBeMotif: 2e3v  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell adhesion    | release date: Thu, Nov 30, 2006
Title crystal structure of the first fibronectin type iii domain o cell adhesion molecule splicing isoform from human muscle c lambda-4.4
Authors A.NISHINO, B.C.WANG, L.CHEN, M.SHI, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, S.KISHISHITA, S.SAIJO, S.YOKOYAMA, Z.J.LIU
Method X-RAY DIFFRACTION (resolution: 1.95Å)
PDBe Citation   
Small molecules:    search PGE PGE binding statistics PGE   search BTB BTB binding statistics BTB   search PEG PEG binding statistics PEG   search EDO EDO binding statistics EDO
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
GSSGSSGPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTY
AVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NEURAL CELL ADHESION MOLECULE 1, 140 KDA ISOFORM
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF34PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF48726/searchSSF49265UniProt:searchP13591
JMol viewer RasMol script viewer  PEG 1004A  ..                     *****  ..     *                         *                                           
sec str:  ........eeeeeee....eeeeee.........eeeeeeeeee......eeeeeehhhhhh..eeee.......eeeeeeeeee..ee......eeee........
sequence :  ..SGPSSPSIDQVEPYSSTAQVQFDEPEAT..VPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPS
seq num:  ..8         18        28      ..38        48        58        68        78        88        98        108  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*       ||   |  |           ..           |  | |      |   |  | |  |  ||  |                                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        ||   |  |           ..           |  | |      *****  | |  |  ||  |                                
search RasMol script viewer Motif-ligand binding stats  betabulge ..        **   |  |           ..           |  | |             | |  |  ||  |                                
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |           ..           |  | |             ***  |  ||  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..             ****           ..           ******                  ********                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NEURAL CELL ADHESION MOLECULE 1, 140 KDA ISOFORM
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF34PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF48726/searchSSF49265UniProt:searchP13591
JMol viewer RasMol script viewer  PEG 1005B  ..                          ..   **                                               *                  
JMol viewer RasMol script viewer  BTB 1009B  ..                          ..   || * *        * *                                |                  
JMol viewer RasMol script viewer  PGE 1007B  ..                          ..   || | |  ***   | |                   *  *         |                  
JMol viewer RasMol script viewer  PGE 1006B  ..                          ..   || | | *|||   * |                   |  |***      |         * *      
sec str:  ........eeeeeee....eeeeee.........eeeeeeee......eeeeeehhhhhh..eeee.......eeeeeeeeee..ee......eeee....
sequence :  ..SGPSSPSIDQVEPYSSTAQVQFDEPE..VPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPV
seq num:  ..8         18        28    ..38        48        58        68        78        88        98         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*       ||   |  |         ..   ||      |  | |             | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betabulge ..        **   |  |         ..   **      |  | |             | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |         ..           **** |             | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |         ..           |  | |             ***  |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..             ****         ..           ******                  ****                                

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : NEURAL CELL ADHESION MOLECULE 1, 140 KDA ISOFORM
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF34PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF48726/searchSSF49265UniProt:searchP13591
JMol viewer RasMol script viewer  PEG 1003C  ..                                                       ** **                                         
JMol viewer RasMol script viewer  BTB 1008C  ..                     * ****     *  *                   || **                                       
JMol viewer RasMol script viewer  EDO 1001C  ..                     | ||||     *  |                  ***| |                                       
sec str:  ........eeeeeee...eeeeeee...........eeeeeeee......eeeeeehhhhhh..eeeee......eeeeeeeeee..ee......eeee....
sequence :  ..SGPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPV
seq num:  ..8         18        28        38        48        58        68        78        88        98         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*       ||   |  |                ||      |  | |      ||  || | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        ||   |  |                ||      |  | |      *****| | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betabulge ..        **   |  |                **      |  | |       |   | | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |                        **** |       |   | | |  |  |                                
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |                        |  | |       |   | ***  |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                        ******       |   |      ****                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                      *****                                          

   New search    2e3v:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors