triangle PDBeMotif: 2e3s  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid transport    | release date: Tue, Nov 28, 2006
Title crystal structure of cert start domain co-crystallized with c24-ceramide (p21)
Authors K.HANADA, K.KUMAGAI, M.NISHIJIMA, N.KUDO, R.KATO, S.WAKATSUKI
Method X-RAY DIFFRACTION (resolution: 1.94Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LIPID-TRANSFER PROTEIN CERT
member of: CATH:search3.30.530.20GENE3D:searchG3DSA_3.30.530.20PANTHER:searchPTHR10219/searchPTHR10219_SF31PFAM:searchPF01852PROSITE PROFILES:searchPS50848, SMART:searchSM00234SUPERFAMILY:searchSSF55961UniProt:searchQ9Y5P4
sec str:  ....hhhhhhhhhhhhhhhh..........eeeeee..eeeee...ee..ee...eeeeeeee..hhhhhhhhhhh..hhhhhh..eeeeeeeeeee..eeeeeeee.......eeeeeeeeeeee.........eeeeeeee............ee.eeeeeeeeeeee.... ...hhh.eeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......
sequence :  ..HRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRV..SQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVS... ..ISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
seq num:  ..365       375       385       395       405       415       425       435       445       455       465     ..476       486       496       506       516       526      ... ..542       552       562       572       582       592    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |         |   ||| |||| | ||  || || |                      |  ||  ||  |  |    |  || ||      | || |     | |  ..| ||             | ||       ^*** |  |  |  |               |..PS00001.. ||| |                                || ||  | | || |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |         |   ||| |||| | ||  || || |                      |  ||  ||  |  |    |  || ||      | || |     | |  ..| ||             | ||            |  |  |  |               |..PS00004.. ||| |                                |**^*  | | || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**         |   ||| |||| | ||  || || |                      |  ||  ||  |  |    |  || ||      | || |     ^**  ..^**|             | ||            |  |  |  |               |..PS00005.. ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |   ||^***|| | ||  || || |                      |  |^***|  |  |    |  |^***      ^*** |          ..^***             ^***            |  |  |  |               ^..PS00006.. ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |   ||  | |^*****  || || |                      |  ||   |  |  |    |  |  |         |  |          ..                 | ||            |  |  |  |                ..PS00008.. ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |   ||  | |  ***|  || || |                      |  ||   |  |  |    |  |  |         |  |          ..                 | ||            |  |  |  |                ..asxturn.. ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |   ||  | |  |  |  ** || |                      |  ||   |  |  |    |  |  |         |  |          ..                 | ||            |  |  |  |                ..betabulge.. ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |   ||  | |  |  |     ****                      |  ||   |  |  |    |  |  |         |  |          ..                 | ||            ****  |  |                ..betaturn.. ||| |                                |   |  | | ****    
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |**** *******      ***                      ****|   |  ****    *******         ****          ..                 ****                  ****                ..niche.. |****                                |   |  | ******    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |   |                                               *****                                        ..                 | |                                       ..stmotif.. | |                                  |   |  |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                            ..                 | |                                       ..ststaple.. | |                                  *****  *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                            ..                 ***                                       ..stturn.. ***                                                     

   New search    2e3s:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors