triangle PDBeMotif: 2e3o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid transport    | release date: Tue, Nov 28, 2006
Title crystal structure of cert start domain in complex with c16- ceramide (p212121)
Authors K.HANADA, K.KUMAGAI, M.NISHIJIMA, N.KUDO, R.KATO, S.WAKATSUKI
Method X-RAY DIFFRACTION (resolution: 1.55Å)
PDBe Citation   
Small molecules:    search 16C 16C binding statistics 16C   search DMS DMS binding statistics DMS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LIPID-TRANSFER PROTEIN CERT
member of: CATH:search3.30.530.20GENE3D:searchG3DSA_3.30.530.20PANTHER:searchPTHR10219/searchPTHR10219_SF31PFAM:searchPF01852PROSITE PROFILES:searchPS50848, SMART:searchSM00234SUPERFAMILY:searchSSF55961UniProt:searchQ9Y5P4
JMol viewer RasMol script viewer  DMS 702A  ..                  *                                                                                                                                                * *      ..DMS ..          ***                                              
JMol viewer RasMol script viewer  DMS 701A  ..                  |***                 *              * *                                                                                                          | |      ..DMS ..          |||                                              
JMol viewer RasMol script viewer  16C 600A  ..                  ||||                 |              | |              *     *   *                    * *  *  *  * * *                     *                * * *  | |      ..16C ..          |||*         *    *  *   **  *                   
sec str:  ....hhhhhhhhhhhhhhhh.........eeeeeee..eeeeee..ee..ee...eeeeeeee..hhhhhhhhhhh..hhhhhh..eeeeeeeeeee..eeeeeeee........eeeeeeeeeeee.........eeeeeeee............ee.eeeeeeeeeeee...... .....hhh.eeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......
sequence :  ..HRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPP... ..QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
seq num:  ..365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525         ... ..540       550       560       570       580       590      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |         |   ||| |||| | ||  || || |                      |  ||  ||  |  | |  |  ||  |    ||| || |     | |  | || ||             |  |       ^*** |  |  | ||               |  ..PS00001..   |||||          | |                   || ||| | | || |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |         |   ||| |||| | ||  || || |                      |  ||  ||  |  | |  |  ||  |    ||| || |     | |  | || ||             |  |            |  |  | ||               |  ..PS00004..   |||||          | |                   |**^*| | | || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**         |   ||| |||| | ||  || || |                      |  ||  ||  |  | |  |  ||  |    ||| || |     ^**  | |^**|             |  |            |  |  | ||               |  ..PS00005..   |||||          | |                   ||  || | | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |   ||^***|| | ||  || || |                      |  |^***|  |  | |  |  |^***    ||^*** |          | |^***             ^***            |  |  | ||               ^**..PS00006..   |||||          | |                   ||  || | | || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |   ||  | |^*****  || || |                      |  ||   |  |  | |  |  |        ||  |  |          | |                 |  |            |  |  | ||                  ..PS00008..   |||||          | |                   ||  || | | || |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |   ||  | |  ***|  || || |                      |  ||   |  |  ***  |  |        ||  |  |          | |                 |  |            |  |  ***|                  ..asxturn..   |||||          ***                   ||  || | | || |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |   ||  | |  |  |  ** || |                      |  ||   |  |  |    |  |        **  |  |          | |                 |  |            |  |  |  |                  ..betabulge..   |||||                                ||  || | | || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |   ||  | |  |  |     ****                      |  ||   |  |  |    |  |            |  |          | |                 |  |            ****  |  |                  ..betaturn..   ****|                                ||  || | | ****    
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |**** *******      ***                      ****|   |  ****    ****            ****          ***                 ****                  ****                  ..niche..   |****                                ||  || | ******    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |   |                                               *****                                                                                                        ..stmotif..   *****                                ||  || |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                                                                                            ..ststaple..   | |                                  ****** *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                            ..stturn..   ***                                                     

   New search    2e3o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors