triangle PDBeMotif: 2e3m  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid transport    | release date: Tue, Nov 28, 2006
Title crystal structure of cert start domain
Authors K.HANADA, K.KUMAGAI, M.NISHIJIMA, N.KUDO, R.KATO, S.WAKATSUKI
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LIPID-TRANSFER PROTEIN CERT
member of: CATH:search3.30.530.20GENE3D:searchG3DSA_3.30.530.20PANTHER:searchPTHR10219/searchPTHR10219_SF31PFAM:searchPF01852PROSITE PROFILES:searchPS50848, SMART:searchSM00234SUPERFAMILY:searchSSF55961UniProt:searchQ9Y5P4
sec str:  .......hhhhhhhhhhhhhhhh..........eeeeee..eeeee...ee..ee...eeeeeeee..hhhhhhhhhhhhhhhhhh...eeeeeeeeeee..eeeeeeee........eeeeeeeeeeee.........eeeeeeee............ee.eeeeeeeeeeee.........hhh.eeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......
sequence :  ..VGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
seq num:  ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |         |   ||| || | | ||  || || |                      |  ||  |   |  |    |  || ||      | || |     | |     | ||             | ||       ^*** |  |  |  |               |  |     ||| |          | |                   || ||  | | || |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | |         |   ||| || | | ||  || || |                      |  ||  |   |  |    |  || ||      | || |     | |     | ||             | ||            |  |  |  |               |  |     ||| |          | |                   |**^*  | | || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ^**         |   ||| || | | ||  || || |                      |  ||  |   |  |    |  || ||      | || |     ^**     ^**|             | ||            |  |  |  |               |  |     ||| |          | |                   |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |   ||^*** | | ||  || || |                      |  |^***   |  |    |  |^***      ^*** |             ^***             ^***            |  |  |  |               ^***     ||| |          | |                   |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |   ||  |  ^*****  || || |                      |  |       |  |    |  |  |         |  |                              | ||            |  |  |  |                        ||| |          | |                   |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |   ||  |    ***|  || || |                      |  |       |  |    |  |  |         |  |                              | ||            |  |  |  |                        ||| |          ***                   |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |   ||  |    |  |  ** || |                      |  |       |  |    |  |  |         |  |                              | ||            |  |  |  |                        ||| |                                |   |  | | || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |   ||  |    |  |     ****                      |  |       |  |    |  |  |         |  |                              | ||            ****  |  |                        ||| |                                |   |  | | ****    
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |****    ****      ***                      ****       ****    *******         ****                              ****                  ****                        |****                                |   |  | ******    
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                                | |                                               | |                                  *****  *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                   ***                                               ***                                                     

   New search    2e3m:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors