triangle PDBeMotif: 2e3h  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification structural protein    | release date: Sun, Nov 26, 2006
Title crystal structure of the clip-170 cap-gly domain 2
Authors R.MAESAKI, T.HAKOSHIMA
Method X-RAY DIFFRACTION (resolution: 1.45Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAK
AKANAVRRVM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RESTIN
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF30PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchP30622
sec str:  ........eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee.............
sequence :  ..ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPST..VRRVM
seq num:  ..211       221       231       241       251       261       271       281   ..296  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |    ^*****  || | | |           | |  ||^*****  |  | |||   || || |  |   ..     
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..  |  |     | |    || ********************************  | |||   || || |  |   ..     
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     | |    ||   | |           | |  ***|         | |||   || || |  |   ..     
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     | |    **   | |           | |   | |         | |||   || || |  |   ..     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     | |         | |           | |   | |         ****|   ***** ****   ..     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     | |         | |           ***   | |           | |    |  | |  |   ..     
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     ***         | |                 ***           ***    |  | |  |   ..     
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                 | |                               ***    **** ****   ..     
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                  ..     

   New search    2e3h:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors