triangle PDBeMotif: 2dsp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding/hormone/growth factor    | release date: Wed, Jul 5, 2006
Title structural basis for the inhibition of insulin-like growth factors by igf binding proteins
Authors G.M.POPOWICZ, I.SIWANOWICZ, R.HUBER, T.A.HOLAK, T.SITAR
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCM
ELAEIEAIQESL
Chain I sequence:
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : INSULIN-LIKE GROWTH FACTOR-BINDING PROTEIN 4
member of: GENE3D:searchG3DSA_4.10.40.20PANTHER:searchPTHR11551/searchPTHR11551_SF7PFAM:searchPF00219PRINTS:searchIGFBPFAMILY/searchIGFBPFAMILY4PROSITE PATTERNS:searchPS00222, PROSITE PROFILES:searchPS51323, SMART:searchSM00121SUPERFAMILY:searchSSF57184UniProt:searchP22692
sec str:  ...........hhhhhhhh........eee.......eee......ee...........eee.......hhhhhhhh..eeeehhhhhhhhhh..
sequence :  ..DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPP..GVEKPLHTLMHGQGVCMELAEIEAIQESL
seq num:  ..1         11        21        31        41        51          ..64        74        84       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            || ||  |  |       | |  |    | || ||| ^** |  |     ..          ||||  |       |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            || ||  |  |       ^*****    | ^***** |   |  |     ..          |^*****       |  | 
search RasMol script viewer Motif-ligand binding stats  IGFBP_N_1 ..            || ||  |  |       ****************|  |   |  |     ..          ||||          |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            *****  |  |       | |       |  |  |  |   |  |     ..          ||||          |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****|  |  |       | |       |  |  |  |   ****     ..          ||||          **** 
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |  |  |       | |       |  |  |  |   |  |     ..          ****               
search RasMol script viewer Motif-ligand binding stats  niche ..             ****  ****       ***       ****  ****   ****     ..           ***               

chain I : INSULIN-LIKE GROWTH FACTOR IB
member of: CATH:search1.10.100.10GENE3D:searchG3DSA_1.10.100.10PANTHER:searchPTHR11454/searchPTHR11454_SF4PFAM:searchPF00049PRINTS:searchINSLNLIKEGF/searchINSLNLIKEGF1/searchINSULINFAMLYPRODOM:searchPD001048PROSITE PATTERNS:searchPS00262, SMART:searchSM00078SUPERFAMILY:searchSSF56994UniProt:searchQ9NP10
sec str:  ......hhhhhhhhhhhhhhhhh...ee.....eehhhhhh....hhhhhhhh........
sequence :  ..PETLCGAELVDALQFVCGDRGFYFNKPT..QTGIVDECCFRSCDLRRLEMYCAPLKPAK
seq num:  ..2         12        22      ..40        50        60       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |         |  |       ..       ||   |     |  |       
search RasMol script viewer Motif-ligand binding stats  INSULIN ..    |  |         |  |       ..       ^^***^********^       
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****         ****       ..                  |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..                            ..                  ****       

   New search    2dsp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors