triangle PDBeMotif: 2dob  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid binding protein    | release date: Fri, Apr 28, 2006
Title crystal structure of human saposin a
Authors G.G.PRIVE, V.E.AHN
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNL
CES
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROACTIVATOR POLYPEPTIDE
member of: CATH:search1.10.225.10GENE3D:searchG3DSA_1.10.225.10PANTHER:searchPTHR11480/searchPTHR11480_SF36PFAM:searchPF03489/searchPF05184PIRSF:searchPIRSF002431PRINTS:searchSAPOSINPROSITE PROFILES:searchPS50015/searchPS51110, SMART:searchSM00741SUPERFAMILY:searchSSF47862UniProt:searchP07602
JMol viewer RasMol script viewer  CA 601A  ..                                    *                                             
sec str:  ...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.....
sequence :  ..GSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES
seq num:  ..0         10        20        30        40        50        60        70          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |           |  |^*** ||     |||||| | ^***| ||           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |           |  | ||  ||     |||||| |     ^**|           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |           |  | |^***|     |||||| |     ^***           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****           |  | ||   |     |||||| |                    |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 **** ||   |     *****| |                    **** |         ||||  
search RasMol script viewer Motif-ligand binding stats  nest ..                    ***|   |       |  | |                       | |         ****  
search RasMol script viewer Motif-ligand binding stats  niche ..                       |   |       ******                       ***               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       *****                                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROACTIVATOR POLYPEPTIDE
member of: CATH:search1.10.225.10GENE3D:searchG3DSA_1.10.225.10PANTHER:searchPTHR11480/searchPTHR11480_SF36PFAM:searchPF03489/searchPF05184PIRSF:searchPIRSF002431PRINTS:searchSAPOSINPROSITE PROFILES:searchPS50015/searchPS51110, SMART:searchSM00741SUPERFAMILY:searchSSF47862UniProt:searchP07602
JMol viewer RasMol script viewer  CA 601A  ..         *                          *                                             
sec str:  ...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.....
sequence :  ..GSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES
seq num:  ..0         10        20        30        40        50        60        70          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |           |  |^*** ||     |||||| | ^***| ||           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |           |  | ||  ||     |||||| |     ^**|           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |           |  | |^***|     |||||| |     ^***           |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****           |  | ||   |     |||||| |                    |  | |         ||||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 **** ||   |     *****| |                    **** |         ||||  
search RasMol script viewer Motif-ligand binding stats  nest ..                    ***|   |       |  | |                       | |         ****  
search RasMol script viewer Motif-ligand binding stats  niche ..                       |   |       ******                       ***               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       *****                                                      

   New search    2dob:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors