triangle PDBeMotif: 2dll  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification cytokine    | release date: Thu, Apr 20, 2006
Title solution structure of the irf domain of human interferon regulator factors 4
Authors C.KUROSAKI, F.HAYASHI, H.P.ZHANG, M.YOSHIDA, RIKEN, S.YOKOYAMA, STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI)
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKT
RLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | || |    |  || ||||    |   ||||       | |  |  || ||     |                | |      |^*** |   |  || ||          |  || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | |^**    |  || ^**|    |   ||||       | |  |  || ||     |                ^**      |  |  |   |  || ||          |  || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||      |  || ||||    |   ||||       | |  |  || ||     |                         |  |  |   |  ^***|          |  || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      |  || ||||    |   ||||       | |  |  || ||     |                         |  |  |   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..  | |       |  || ||||    **********************************                         |  |  |   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |       ***** ||||        ||||       | |  |  || ||                               |  |  |   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |       ****  ||||        ||||       | |  |  *****                               |  ****   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***             ||||        ||||       | |  |                                      |  |  |   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ****        ****       ***  |                                      |  |  |   |  ||  |          |  || | 
search RasMol script viewer Motif-ligand binding stats  niche ..                   ***                     ****                                      *******   ********          ******* 

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | | |  |||   ||||  | |   ||||         |  | |  ||     || ||| |          | |      |^*** |   |  |  |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^** |  |||   ^**|  | |   ||||         |  | |  ||     || ||| |          ^**      |  |  |   |  |  |                   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |   |  |||   ||||  | |   ||||         |  | |  ||     || ||| |                   |  |  |   |  ^***                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  |||   ||||  | |   ||||         |  | |  ||     || ||| |                   |  |  |   |  |                      
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..         |  |||   ||||  | ********************************** ||| |                   |  |  |   |  |                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *****|   ||||  |     ||||         |  | *****     *****| |                   |  |  |   |  |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         **** |   ||||  |     ||||         |  | ****      **** | |                   ****  |   |  |                      
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****  |     ****         |  |                ***                   |  |  |   |  |                      
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******      ***         ****                                      *******   ****                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |    | ||| ||||    |   ||||   | |   || |   |  |    || ||     | |     | |      |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**    | ||| ^**|    |   ||||   | |   || |   |  |    || ||     | |     ^**      |  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      | ||| ||||    |   ||||   | |   || |   |  |    || ||     | |              |  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      | ||| ||||    |   ||||   | |   || |   |  |    || ||     | |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..            | ||| ||||    ********************************** ||     | |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            ***** ||||        ||||   | |   || |   |  |    *****     | |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****  ||||        ||||   | |   ****   ****    ****      | |              ****  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****        ****   | |    | |                     | |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***         ***   ***    ***                     ***              *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | || |    ||||| ||||  | |   ||||          | |  || || |  ||                | |||||| |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | |^**    ||||| ^**|  | |   ||||          | |  || || |  ||                ^**||||| |  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||      ||||| ||||  | |   ||||          | |  || || |  ||                | |||||| |  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      ||||| ||||  | |   ||||          | |  || || |  ||                | |||||| |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..  | |       ||||| ||||  | **********************************                | |||||| |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |       ***** ||||  |     ||||          | |  ***** *****                ******** |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |       ***** ||||  |     ||||          | |  ***** ****                 *******  |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |         |   ****  |     ****          | |                                      |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..  ***         |   |******                   ***                                      *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |   || ||| ||||    |   ||||   | |    | |   |  |  |||| |              ||| |    |^*** |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**   || ||| ^**|    |   ||||   | |    | |   |  |  |||| |              ^** |    |  |  |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     || ||| ||||    |   ||||   | |    | |   |  |  |||| |               |  |    |  |  |   |  ^***|             | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||    |   ||||   | |    | |   |  |  |||| |               |  |    |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..           || ||| ||||    ********************************** |               |  |    |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |***** ||||        ||||   | |    | |   |  *****|  |               |  |    |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           *****  ||||        ||||   | |    | |   ******* ****               ****    ****  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****        ****   | |    | |                                      |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***         ***   ***    ***                                      *******   ********             ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |   || ||| ||||    |   ||||   | | | |  |   |  |    || |              | |      |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**   || ||| ^**|    |   ||||   | | | |  |   |  |    || |              ^**      |  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     || ||| ||||    |   ||||   | | | |  |   |  |    || |                       |  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||    |   ||||   | | | |  |   |  |    || |                       |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..           || ||| ||||    ********************************** |                       |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |***** ||||        ||||   | | | |  |   |  |    |  |                       |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           *****  ||||        ||||   | | | |  |   ****    ****                       ****  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |   ||||        ||||   | | ***  |                                      |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****        ****   | |   |  |                                      |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***               ***   ****                                      *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | | |    | ||| ||||    |   ||||   | |   |  |   |  | |  || ||            || ||     |^*** |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | ^**    | ||| ^**|    |   ||||   | |   |  |   |  | |  || ||            |^**|     |  |  |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| | |      | ||| ||||    |   ||||   | |   |  |   |  | |  || ||            |  ||     |  |  |   |  ^***|             | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      | ||| ||||    |   ||||   | |   |  |   |  | |  || ||            |  ||     |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  IRF_1 .. | |        | ||| ||||    ********************************** ||            |  ||     |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |        ***** ||||        ||||   | |   |  |   |  | ********            *****     |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |        ****  ||||        ||||   | |   |  |   **** *******             ****      *******   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  nest .. ***          |   ****        ****   | |   |  |                                      |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***         ***   ***   ****                                      *******   ********             ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |   || ||| ||||  | |   ||||      |  |  |   |  |     |        | |     |||||     ^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**   || ||| ^**|  | |   ||||      |  |  |   |  |     |        | |     ^**||     | |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     || ||| ||||  | |   ||||      |  |  |   |  |     |        | |     || ||     | |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||  | |   ||||      |  |  |   |  |     |        | |     || ||     | |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..           || ||| ||||  | **********************************        | |     || ||     | |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |***** ||||  |     ||||      |  |  |   |  |              | |     || ||     | |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           *****  ||||  |     ||||      ****  |   ****              | |     *****     | |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****  |     ****         |  |                     | |               | |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******      ***         ****                     ***               ******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |   || ||| ||||    |   ||||          | |  || ||     |  ||||| | |    || | |  |||^*** | | |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**   || ||| ^**|    |   ||||          | |  || ||     |  ||||| | |    |^** |  |||  |  | | |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     || ||| ||||    |   ||||          | |  || ||     |  ||||| | |    |  | |  |||  |  | | |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||    |   ||||          | |  || ||     |  ||||| | |    |  | |  |||  |  | | |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..           || ||| ||||    **********************************  ||||| | |    |  | |  |||  |  | | |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |***** ||||        ||||          | |  || ||        ||||| | |    |  | *****|  |  | | |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           *****  ||||        ||||          | |  *****        ||||| | |    **** **** |  |  | | ****|  |                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |   ||||        ||||          | |               ||||| | |              |  |  | ***  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****        ****          | |               ******* |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***                      ***                ***  ***              *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | ||||  || ||| ||||    |   ||||   | | | |  | | |  |  ||||||      | |  |  ||| |  |||^*** |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | ^**|  || ||| ^**|    |   ||||   | | | |  | | |  |  ||||||      | |  |  ^** |  |||  |  |   |  || ||             | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | || |  || ||| ||||    |   ||||   | | | |  | | |  |  ||||||      | |  |   |  |  |||  |  |   |  ^***|             | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****| |  || ||| ||||    |   ||||   | | | |  | | |  |  ||||||      | |  |   |  |  |||  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..   | || |  || ||| ||||    **********************************||      | |  |   |  |  |||  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | || |  |***** ||||        ||||   | | | |  | | |  *****| ||      | |  |   |  *****|  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | || |  || ||  ||||        ||||   | | | |  | | |  |  ||| ||      | |  *****  |  | |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | || |  *****  ||||        ||||   | | | |  | | ************      | |         **** ****  |   ****|  |             | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |***     |   ||||        ||||   | | | |  ***                   | |              |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  nest ..   | |        |   ****        ****   | | | |  |                     | |              |  |  |   |  ||  |             | |  
search RasMol script viewer Motif-ligand binding stats  niche ..   ***        |   |***               *** ******                     ***              *******   ********             ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |||| | || ||| ||||  | |   ||||   | |   |  |            || ||||       |  | | |  |||^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |^** | || ||| ^**|  | |   ||||   | |   |  |            || ||||       |  ^** |  |||  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |||| | || ||| ||||  | |   ||||   | |   |  |            || ||||       |  |   |  |||  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|| | || ||| ||||  | |   ||||   | |   |  |            || ||||       |  |   |  |||  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..    | || | || ||| ||||  | **********************************| ||||       |  |   |  |||  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | || | ****** ||||  |     ||||   | |   |  |            || ||||       |  |   *****|  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | || | *****  ||||  |     ||||   | |   |  |            |****||       ****   **** ****  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..    ******    |   ****  |     ****   | |   |  |            |  ****                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******      ***   ***   ****            |    |                    *******   ********                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              |   |                                        ******                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | | |   || ||| ||||    |   ||||   | |   |  |  |  |      |       |  |     ||| |    |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | ^**   || ||| ^**|    |   ||||   | |   |  |  |  |      |       |  |     ^** |    |  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |     || ||| ||||    |   ||||   | |   |  |  |  |      |       |  |      |  |    |  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||    |   ||||   | |   |  |  |  |      |       |  |      |  |    |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..   | |     || ||| ||||    **********************************       |  |      |  |    |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     |***** ||||        ||||   | |   |  |  |  |              |  |      |  |    |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     *****  ||||        ||||   | |   |  |  ****              |  |      ****    |  |  |   ****|  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..   | |        |   ****        ****   | |   |  |                    |  |              |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..   ***        |   |***               ***   ****                    ****              *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    ||||  || ||| ||||    |   ||||         |  |   |  |     |             | ||||       ^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**|  || ||| ^**|    |   ||||         |  |   |  |     |             | |^**          | |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    || |  || ||| ||||    |   ||||         |  |   |  |     |             | | ||          | |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****| |  || ||| ||||    |   ||||         |  |   |  |     |             | | ||          | |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..      | |  || ||| ||||    **********************************             | | ||          | |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  ****** ||||        ||||         |  |   |  |                   | | ||          | |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | |  || ||  ||||        ||||         |  |   |  |                   *****|          | |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  *****  ||||        ||||         |  |   ****                     ****          | |   ****|  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..      ***     |   ****        ****         |  |                                          | |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***                     ****                                          ***   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |    | ||||||||    | | ||||   | |   |  |||||  |     |  ||||          ||| | ||||^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**    | ||||^**|    | | ||||   | |   |  |||||  |     |  ||||          ^** | ||||  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      | ||||||||    | | ||||   | |   |  |||||  |     |  ||||           |  | ||||  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      | ||||||||    | | ||||   | |   |  |||||  |     |  ||||           |  | ||||  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..            | ||||||||    **********************************  ||||           |  | ||||  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            *****|||||      | ||||   | |   |  |||||  |        ||||           |  *****|  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ******||||      ****||   | |   |  ||||****        ||||           *********  |  |   ****|  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****        ****   | |   |  |****           ****                  ||  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***               ***   ****                                     |*******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                 *****                                

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   ||||    | ||| ||||  | |   ||||   | |   |  | ||| ||    || ||          |  ||| | | ||^*** |  ||  || ||          |  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |^**    | ||| ^**|  | |   ||||   | |   |  | ||| ||    || ||          |  ^** | | |||||  |  ||  || ||          |  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |||     | ||| ||||  | |   ||||   | |   |  | ||| ||    || ||          |  ||  | | |||||  |  ||  ^***|          |  | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|     | ||| ||||  | |   ||||   | |   |  | ||| ||    || ||          |  ||  | | |||||  |  ||  ||  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..    | |     | ||| ||||  | ********************************** ||          |  ||  | | |||||  |  ||  ||  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     ***** ||||  |     ||||   | |   |  | |*****    *****          |  ||  | *****||  |  ||  ||  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     ****  ||||  |     ||||   | |   |  | |*****    ****           ******** **********  |****|  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |       |   ||||  |     ||||   | |   |  ***                                   ||  |  |  ||  ||  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  nest ..    ***       |   ****  |     ****   | |   |  |                                     ||  |  |  ||  ||  |          |  | |  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******            ***   ****                                     |*******  |********          ******  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                 *****     *****                      

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |   || ||| ||||  | |   ||||         |  |  |  |      |   | |          | |      |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**   || ||| ^**|  | |   ||||         |  |  |  |      |   | |          ^**      |  |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     || ||| ||||  | |   ||||         |  |  |  |      |   | |                   |  |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||  | |   ||||         |  |  |  |      |   | |                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..           || ||| ||||  | **********************************   | |                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           ****** ||||  |     ||||         |  |  |  |          | |                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           *****  ||||  |     ||||         |  |  ****          | |                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****  |     ****         |  |                ***                   |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******      ***         ****                                      *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |    | ||| ||||  | |   ||||               || ||     |  ||||          | |      |^*** |   |  || ||          | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ^**    | ||| ^**|  | |   ||||               || ||     |  ||||          ^**      |  |  |   |  || ||          | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      | ||| ||||  | |   ||||               || ||     |  ||||                   |  |  |   |  ^***|          | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      | ||| ||||  | |   ||||               || ||     |  ||||                   |  |  |   |  ||  |          | |     
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..            | ||| ||||  | **********************************  ||||                   |  |  |   |  ||  |          | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            ***** ||||  |     ||||               *****        ||||                   |  |  |   |  ||  |          | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****  ||||  |     ||||               *****        ||||                   ****  |   ****|  |          | |     
search RasMol script viewer Motif-ligand binding stats  nest ..              |   ****  |     ****                            ****                   |  |  |   |  ||  |          | |     
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******                                      ***                   *******   ********          ***     
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | | |      |  |||||    |   ||||         |  |   |  |    || |              | |      |^***     |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | ^**      |  |^**|    |   ||||         |  |   |  |    || |              ^**      |  |      |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |        |  |||||    |   ||||         |  |   |  |    || |                       |  |      |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        |  |||||    |   ||||         |  |   |  |    || |                       |  |      |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..   | |        |  |||||    ********************************** |                       |  |      |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |        ****||||        ||||         |  |   ****    ****                       |  |      |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..   | |            ****        ****         |  |                                      |  |      |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..   ***             ***                     ****                                      ****      ********                  

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | | |   || ||| ||||  | |   ||||   | |   |  ||  || |    || ||             | |   |  |^*** |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | ^**   || ||| ^**|  | |   ||||   | |   |  ||  || |    || ||             ^**   |  || |  |   |  || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |     || ||| ||||  | |   ||||   | |   |  ||  || |    || ||                   |  || |  |   |  ^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||  | |   ||||   | |   |  ||  || |    || ||                   |  || |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..   | |     || ||| ||||  | ********************************** ||                   |  || |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     |***** ||||  |     ||||   | |   |  |***** |    *****                   ***** |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     *****  ||||  |     ||||   | |   |  |*******    ****                    ****  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..   ***        |   ****  |     ****   | |   |  |                                      |  |  |   |  ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |******            ***   ****                                      *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON REGULATORY FACTOR 4
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11949/searchPTHR11949_SF6PFAM:searchPF00605PRINTS:searchINTFRNREGFCTPROSITE PATTERNS:searchPS00601, PROSITE PROFILES:searchPS51507, SMART:searchSM00348SUPERFAMILY:searchSSF46785UniProt:searchQ15306
sec str:  ..........hhhhhhhhhhh......ee......eeeee..........hhhh.hhhhhhhhhh.............hhhhhhhhhhhh...eee............eeeeee.........
sequence :  ..GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||| |   || ||| ||||    |   ||||         |  |   |  |     |                | | |  |||^*** |   |  || ||           | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |||^**   || ||| ^**|    |   ||||         |  |   |  |     |                ^** |  |||  || |   |  || ||           | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||||     || ||| ||||    |   ||||         |  |   |  |     |                    |  |||  || |   |  ^***|           | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     || ||| ||||    |   ||||         |  |   |  |     |                    |  |||  || |   |  ||  |           | |    
search RasMol script viewer Motif-ligand binding stats  IRF_1 ..  ||||     || ||| ||||    **********************************                    |  |||  || |   |  ||  |           | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||||     |***** ||||        ||||         |  |   |  |                          *****|  || |   |  ||  |           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ||||     *****  ||||        ||||         |  |   ****                          **** |  || |   |  ||  |           | |    
search RasMol script viewer Motif-ligand binding stats  nest ..  ****        |   ****        ****         |  |                                      |  || |   |  ||  |           ***    
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |***                     ****                                      *******   ********                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                                                                      

   New search    2dll:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML