triangle PDBeMotif: 2d9y  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification signaling protein    | release date: Tue, Dec 13, 2005
Title solution structure of the ph domain of pepp-3 from human
Authors H.LI, M.INOUE, N.TOCHIO, RIKEN, S.KOSHIBA, S.YOKOYAMA, STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI), T.KIGAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAE
HAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                                        ||||      | |||       |^***||| |  | |         |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                                        ||||      | |||       | ||**^* |  | |         |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                                        ||||      | ^**       | |^** ^**  | |         |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                                        ||||      |  |        | |         | |         ^***         |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                        ||||      |  |        | |         | |                      |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****      |  |        ***         ***                      |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ****                                             ****        

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                  | |                   ||||       ||||       |^***||| |  | | |       |  |     |  ||  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                  | |                   ||||       ||||       | ||**^* |  | | |       |  |     |  ||  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                  | |                   ||||       |^**       | |^** ^**  | | |       |  |     |  ||  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                  | |                   ||||       | |        | |         | | |       ^***     |  ||  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                   ||||       | |        | |         | | |                |  ||  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |                   ||||       | |        | |         | | |                *****  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |                   ||||       | |        | |         | | |                ********        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***                   ||||       | |        | |         *** |                    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****       | |        ***           ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         ***                                             ****        

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |||                                       ||||      | |||    |  |^***||| |  | |         |  |         |  |  || |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|   |||                                       ||||      | |||    |  | ||**^* |  | |         |  |         |  |  || |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||                                       ||||      | ^**    |  | |^** ^**  | |         |  |         |  |  || |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |||                                       ||||      |  |     |  | | |       | |         ^***         |  |  || |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|                                       ||||      |  |     |  | | |       | |                      |  |  || |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |                                       ||||      |  |     **** | |       | |                      |  |  || |  
search RasMol script viewer Motif-ligand binding stats  nest ..    | |                                       ****      |  |        *** |       ***                      |  |  || |  
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                                 ****          ***                                **********  

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                                      | ||||        | |    |  |^***||| |              |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                                      | ||||        | |    |  ||||**^* |              |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                                      | ||||        ^**    |  |||^** ^**              |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                                      | ||||               |  |||||  |                ^***         |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                      | ||||               |  |||||  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                            ***|||               |  |||||  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                              ||||               ****||||  |                             ****        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****                  *****  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                        ****                             ****        

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||                  | |                   ||||      | |||    |  |^***||| |    | |     | |  ||  ||    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| | ||                  | |                   ||||      | |||    |  | ||**^* |    | |     | |  ||  ||    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | ||                  | |                   ||||      | ^**    |  | |^** ^**    | |     | |  ||  ||    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||                  | |                   ||||      |  |     |  | | |  |      | |     | ^***|  ||    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                   ||||      |  |     |  | | |  |      | |     | |   |  ||    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |                   | |                   ||||      |  |     |  | | |  |      | |     | |   *****    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |                   | |                   ||||      |  |     **** | |  |      | |     | |   ****     |  |   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |                   ***                   ||||      |  |        | | |  |      | |     | |            |  |   ***  
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                                         ****      |  |        *** |  |      ***     | |            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ****            ****              ***            ****        

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    || |                                     ||||        | |       |^***||| |  | |       | |  |        || |||  |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    || |                                     ||||        | |       | ||**^* |  | |       | |  |        || |||  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |                                     ||||        ^**       | |^** ^**  | |       | |  |        || |||  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    || |                                     ||||                  | | |  |    | |       | ^***        || |||  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****| |                                     ||||                  | | |  |    | |       | |           || |||  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |                                     ||||                  | | |  |    | |       | |           *****|  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                     ||||                  | | |  |    | |       | |           ****|****    
search RasMol script viewer Motif-ligand binding stats  nest ..      | |                                     ****                  *** |  |    ***       | |            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..      ***                                                               ****              ***            ****        

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |             |||| | |        |  |       ||||        | |       |^***||| |  | |         |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||        | |       | ||**^* |  | |         |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||        ^**       | |^** ^**  | |         |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||                  | | |  |    | |         ^***|  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |||| | |        |  |       ||||                  | | |  |    | |             |  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |||| | |        |  |       ||||                  | | |  |    | |             *****   *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |||| | |        |  |       ||||                  | | |  |    | |             ****    ****|        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   ***| ***        |  |       ||||                  | | |  |    | |                      |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |            |  |       ****                  *** |  |    ***                      |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***            ****                                 ****                             ****        

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |  |              | | | |                 | ||||      | |||       |^***||| |              |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |  |              | | | |                 | ||||      | |||       ||||**^* |              |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |  |              | | | |                 | ||||      | ^**       |||^** ^**              |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |  |              | | | |                 | ||||      |  |        |||||  |                ^***        || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | | | |                 | ||||      |  |        |||||  |                            || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |                 | | | |                 | ||||      |  |        |||||  |                            *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |                 | | | |                 ****||      |  |        |||||  |                            *****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                 | | ***                   ||||      |  |        |||||  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |                       ****      |  |        *****  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***                                 ****            ****                             ****        

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |             | |  | |        |  |       ||||      | |||       |^***||| |    | |       |  ||  ||   || ||   | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |             | |  | |        |  |       ||||      | |||       | ||**^* |    | |       |  ||  ||   || ||   | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |             | |  | |        |  |       ||||      | ^**       | |^** ^**    | |       |  ||  ||   || ||   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |             | |  | |        |  |       ||||      |  |        | |           | |       ^***|  ||   || ||   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | |  | |        |  |       ||||      |  |        | |           | |           |  ||   || ||   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |             | |  | |        |  |       ||||      |  |        | |           | |           *****   *****   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |             | |  | |        ****       ||||      |  |        | |           | |           ****    *****   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***             ***  ***                   ||||      |  |        | |           | |                    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****      |  |        ***           ***                    |  |   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ****                                             ****   ***  

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |             |||| | |        |  |       ||||        | |    |  |^***||| |    | |       |  ||  |    || || | |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||        | |    |  | ||**^* |    | |       |  ||  |    || || | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||        ^**    |  | |^** ^**    | |       |  ||  |    || || | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |             |||| | |        |  |       ||||               |  | | |         | |       ^***|  |    || || | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |||| | |        |  |       ||||               |  | | |         | |           |  |    || || | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |||| | |        |  |       ||||               |  | | |         | |           |  |    ***** | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |||| | |        ****       ||||               **** | |         | |           ****    ****| | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   ***| ***                   ||||                  | | |         | |                    |  | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |                       ****                  *** |         ***                    |  | ***    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***                                               ***                                ****        

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |             | |  | |                 | ||||       ||||       |^***||| |  | |         |  ||  || |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |             | |  | |                 | ||||       ||||       | ||**^* |  | |         |  ||  || |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             | |  | |                 | ||||       |^**       | |^** ^**  | |         |  ||  || |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |             | |  | |                 | ||||       | |        | |         | |         ^***|  || |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | |  | |                 | ||||       | |        | |         | |             |  || |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | |  | |                 | ||||       | |        | |         | |             ***** |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                   | |  | |                 *****|       | |        | |         | |             |  |  |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   | |  | |                 ***|||       | |        | |         | |             |  |  |  |  |    | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |  | |                 ****||       | |        | |         | |             ****  ****  |    | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   ***  | |                   ||||       | |        | |         ***                      |  |    *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                   ****       | |        ***                                  |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         ***                                             ****        

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |                | |        |  |       ||||        | |       |^***||| |   ||||       |  |        || ||     | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    | |                | |        |  |       ||||        | |       | ||**^* |   ||||       |  |        || ||     | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    | |                | |        |  |       ||||        ^**       | |^** ^**   ||||       |  |        || ||     | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    | |                | |        |  |       ||||                  | | |  |     ||||       ^***        || ||     | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^***** |                | |        |  |       ||||                  | | |  |     ||||                   || ||     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |                | |        |  |       ||||                  | | |  |     ||||                   *****     | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                | |        ****       ||||                  | | |  |     ||||                   *****     | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                ***                   ||||                  | | |  |     ||||                    |  |     | |
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                                      ****                  *** |  |     ****                    |  |     ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                        ****                             ****        

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |              | |                       ||||      | |||       |^***||| |    | |       |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |              | |                       ||||      | |||       | ||**^* |    | |       |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |                       ||||      | ^**       | |^** ^**    | |       |  |         |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |              | |                       ||||      |  |        | | |         | |       ^***         |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |                       ||||      |  |        | | |         | |                    |  |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |                       ||||      |  |        | ***         | |                    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |                       ****      |  |        ***           ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***                                 ****                                             ****        

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                                        ||||      | |||       |^***||| |  | |         |  |         |  || |  | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                                        ||||      | |||       | ||**^* |  | |         |  |         |  || |  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                                        ||||      | ^**       | |^** ^**  | |         |  |         |  || |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                                        ||||      |  |        | |         | |         ^***         |  || |  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                        ||||      |  |        | |         | |                      |  || |  | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                              ||||      |  |        | |         | |                      |  |***  | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****      |  |        ***         ***                      |  |     ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ****                                             ****        

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                  | |                   ||||     | || |       |^***||| |    | |       |  ||  |     |  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                  | |                   ||||     | || |       | ||**^* |    | |       |  ||  |     |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                  | |                   ||||     | |^**       | |^** ^**    | |       |  ||  |     |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                  | |                   ||||     | |          | | |  |      | |       ^***|  |     |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                   ||||     | |          | | |  |      | |           |  |     |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |                   ||||     | |          | | |  |      | |           ****     |  |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***                   ||||     | |          | | |  |      | |                    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****     | |          *** |  |      ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ***              ****                             ****        

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |              | |                     | ||||     | || |       |^***||| |    | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |              | |                     | ||||     | || |       ||||**^* |    | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |                     | ||||     | |^**       |||^** ^**    | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |              | |                     | ||||     | |          |||||  |      | |       ^***        || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |                     | ||||     | |          |||||  |      | |                   || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    | |                     | ||||     | |          |||||  |      | |                   *****        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                    | |                     *****|     | |          |||||  |      | |                   || ||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                    | |                     ***|||     | |          |||||  |      | |                   || ||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |                     ****||     | |          |||||  |      | |                   ****|        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |                       ||||     | |          |***|  |      | |                    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |                       ****     | |          *** |  |      ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***                                ***              ****                             ****        

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                  | |                 | ||||       ||||    |  |^***||| |  | | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                  | |                 | ||||       ||||    |  ||||**^* |  | | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                  | |                 | ||||       |^**    |  |||^** ^**  | | |       |  |        || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                  | |                 | ||||       | |     |  |||||  |    | | |       ^***        || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                 | ||||       | |     |  |||||  |    | | |                   || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |                 | ||||       | |     |  |||||  |    | | |                   *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |                 ****||       | |     ****||||  |    | | |                   *****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***                   ||||       | |        |||||  |    *** |                    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****       | |        *****  |      ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         ***            ****                             ****        

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                  | |                   ||||        ||||      |^***||| |              |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                  | |                   ||||        ||||      | ||**^* |              |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                  | |                   ||||        ^**|      | |^** ^**              |  ||  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                  | |                   ||||         | |      | | |                   ^***|  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                   ||||         | |      | | |                       |  ||   || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |                   ||||         | |      | | |                       *****   *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |                   ||||         | |      | | |                       ****    ****|        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***                   ||||         | |      | | |                                |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****         | |      *** |                                |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***        ***                                ****        

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |                                        ||||       ||||       |^***||| |  | |         |  |        || ||| |     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |                                        ||||       ||||       | ||**^* |  | |         |  |        || ||| |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |                                        ||||       |^**       | |^** ^**  | |         |  |        || ||| |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |                                        ||||       | |        | |         | |         ^***        || ||| |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                        ||||       | |        | |         | |                     || ||| |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |                                        ||||       | |        | |         | |                     *****| |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                                        ||||       | |        | |         | |                     ****|| |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |                                        ||||       | |        | |         | |                      |  |***     
search RasMol script viewer Motif-ligand binding stats  nest ..   | |                                        ****       | |        ***         ***                      |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                                                   ***                                             ****        

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING PROTEINFAMILY A MEMBER 6;
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR12752/searchPTHR12752_SF5PFAM:searchPF00169PROSITE PROFILES:searchPS50003, SMART:searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ9Y2H5
sec str:  ..............eeeeeeee.......eeeeeeeee..eeeee.........eeee....eeee...........eeeee.....eeeee...hhhhhhhhhhhhhh..........
sequence :  ..GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                  | |                   ||||      | |||    |  |^***||| |              |  ||  ||    |  |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                  | |                   ||||      | |||    |  | ||**^* |              |  ||  ||    |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                  | |                   ||||      | ^**    |  | |^** ^**              |  ||  ||    |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                  | |                   ||||      |  |     |  | |                     ^***|  ||    |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                  | |                   ||||      |  |     |  | |                         |  ||    |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |                   ||||      |  |     |  | |                         *****    |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | |                   ||||      |  |     **** |                         ****     |  |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***                   ||||      |  |        | |                                  |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                              ****      |  |        ***                                  |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ****                                             ****        

   New search    2d9y:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML