triangle PDBeMotif: 2d9h  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification dna binding protein    | release date: Fri, Dec 9, 2005
Title solution structure of the forth and fifth zf-c2h2 domains of zinc finger protein 692
Authors F.HAYASHI, GENOMICS/PROTEOMICS INITIATIVE (RSGI), H.P.ZHANG, RIKEN STRUCTURAL, S.YOKOYAMA, T.NAGASIMA
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**    || ||| ||     ||| |  | ||   |  |||| || |       | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || ||| ||     ||| |  | ||   |  |||| || |       | |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |       || ||| ||     ||| |  ^***   |  |||| || |       | |      
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^|     ||| ^**^************^****^       | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |       *********     |||    | |    **********         | |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |       || ||  |      |**    | |    |  | |  |          | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |       ********      | |    | |    **** ****          | |      
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                       | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                              ***      

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | |   |  | |^**|   || ||| |      | | |  | ||   |  ||||||| |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||| |      | | |  | ||   |  ||||||| |                
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |     |  | | | |   || ||| |      | | |  ^***   |  ||||||| |                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 .. | |     ^**^************^***^      | | ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |        | | | |   ******        | |    | |    **********                  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |        | | | |   *****         | |    | |    *********                   
search RasMol script viewer Motif-ligand binding stats  nest .. ***        *** | |                 | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                 ***                                       

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | ||   |  | |^**    || || || ||  |||| |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || || || ||  |||| |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | |    |  | |       || || || ||  |||| |  ^***   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..  | |    ^**^************^***^ ||  |||| ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |       | |       ***** *****  ||||    | |    **********                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |       | |       || || |  ||  ||**    | |    |  | |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |       | |       ***** ********| |    | |    **** ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..  | |       ***                     | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..  ***                               ***                                       

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**  | |||||||| || | ||| |  | ||   |  |||| || |     | ||  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |     | |||||||| || | ||| |  | ||   |  |||| || |     | ||  |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |     | |||||||| || | ||| |  ^***   |  |||| || |     | ||  |    
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^ || | ||| ^**^************^****^     | ||  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |     ************* | |||    | |    **********       | ||  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |     | || || || |  | |**    | |    |  | |  |        | ||  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |     ************  | | |    | |    **** ****        | |****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                   | | |    | |                     ***        
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                   | | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                  *****                                       

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||| |||||  | | |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||| |||||  | | |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||| |||||  | | |  ^***   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^||||  | | ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   ************  | |    | |    ***********                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   ***********   | |    | |    **** *****                  
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |                 | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                 ***                                       

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||  |  ||  ||| |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||  |  ||  ||| |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||  |  ||  ||| |  ^***   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^  ||  ||| ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   *****  *****  |||    | |    **********                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | | | |   || ||  |  |   |**    | |    |  | |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   *****  ****   | |    | |    **** ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |                 | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                 ***                                       

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||| |  |  |||| |  | ||   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||| |  |  |||| |  | ||   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||| |  |  |||| |  ^***   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^  |  |||| ^**^************^****^           | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   ******    |  ||||    | |    **********             | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | | | |   || ||     |  ||**    | |    |  | |  |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   *****     ****| |    | |    **** ****              | |  
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |                 | |    ***                           | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                 ***                                  ***  

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||| || ||  | | |  | ||   |  |||| || |     | |||| | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||| || ||  | | |  | ||   |  |||| || |     | |||| | | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||| || ||  | | |  ^***   |  |||| || |     | |||| | | 
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^| ||  | | ^**^************^****^     | |||| | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   ************  | |    | |    **********       | |||| | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   ***********   | |    | |    **** ****        | |||| | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | | | |                 | |    | |                     ***||| | | 
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |                 | |    ***                       **** | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                 ***                               *** *** 

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||  |    | | | |  | ||   |  |||| || |      |  |   | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||  |    | | | |  | ||   |  |||| || |      |  |   | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||  |    | | | |  ^***   |  |||| || |      |  |   | |
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^    | | | ^**^************^****^      |  |   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   *****       | | |    | |    **********        |  |   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   *****       | | |    | |    **** ****         |  |   | |
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |               | | |    ***                      |  |   ***
search RasMol script viewer Motif-ligand binding stats  niche ..                ***               *****                             ****      

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||||| || | ||| |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||||| || | ||| |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||||| || | ||| |  ^***   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^ || | ||| ^**^************^****^  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   *********** | |||    | |    **********    | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | | | |   || || |  |  | |**    | |    |  | |  |     | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   ***** ****  | | |    | |    **** ****     | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |               | | |    ***                  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                ***               *****                         ***           

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**|   || ||||| ||    || |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | | | |   || ||||| ||    || |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | | | |   || ||||| ||    || |  ^***   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^ ||    || ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | | |   ***********    ||    | |    ***********                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | | | |   || || || ||    **    | |    |  | || ||                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | | |   ***********          | |    **** *****                  
search RasMol script viewer Motif-ligand binding stats  nest ..            *** | |                        ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                ***                                                           

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**    || || ||   |  | | |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || || ||   |  | | |  | ||   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |       || || ||   |  | | |  ^***   |  |||| || |                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^   |  | | ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |       ***** |    |  | |    | |    **********                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |       *******    |  | |    | |    **** ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                  |  | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ******                                       

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**    |  || ||      ||| |  | ||   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       |  || ||      ||| |  | ||   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |       |  || ||      ||| |  ^***   |  |||| || |           | |  
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^      ||| ^**^************^****^           | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |       ***** |       |||    | |    **********             | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |       |  |  |       |**    | |    |  | |  |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |       *******       | |    | |    **** ****              | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                     | |    | |                           ***  
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                                       

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |   |  | |^**    || ||||| ||   | | |  | ||   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || ||||| ||   | | |  | ||   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | |   |  | |       || ||||| ||   | | |  ^***   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..   | |   ^**^************^***^ ||   | | ^**^************^****^  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |      | |       ***********   | |    | |    ***********   | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |      | |       **********    | |    | |    **** *****    | |           
search RasMol script viewer Motif-ligand binding stats  nest ..   ***      ***                     | |    ***                  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                         ***           

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**    || ||| || ||  ||| |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || ||| || ||  ||| |  | ||   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |       || ||| || ||  ||| |  ^***   |  |||| ||||                
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^| ||  ||| ^**^************^****^                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |       ************  |||    | |    ***********                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |       || ||  |  |   |**    | |    |  | || ||                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |       ***********   | |    | |    **** *****                  
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                                       

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**  |  | ||||| |    ||| |  | ||   |  |||| ||||           | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |     |  | ||||| |    ||| |  | ||   |  |||| ||||           | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |     |  | ||||| |    ||| |  ^***   |  |||| ||||           | |  
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^ |    ||| ^**^************^****^           | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |     |  *****|| |    |||    | |    ***********            | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |     |  |  | || |    |**    | |    |  | || ||             | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |     ************    | |    | |    **** *****             | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                     | |    | |                           ***  
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                                       

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**     | ||| |      | | |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |        | ||| |      | | |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |        | ||| |      | | |  ^***   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^      | | ^**^************^****^  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |        *****        | |    | |    **********    | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |        ****         | |    | |    **** *****    | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                         ***           

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**     | ||  || ||| | | |  | ||   |  |||| || |           |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |        | ||  || ||| | | |  | ||   |  |||| || |           |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |        | ||  || ||| | | |  ^***   |  |||| || |           |||| 
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^| ||| | | ^**^************^****^           |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |        |  ********| | |    | |    **********             |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |        ********** | | |    | |    **** *****             |||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                   | | |    | |                           ***| 
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                   | | |    ***                            | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                  *****                                   *** 

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**    || ||  |      ||| |  | ||   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |       || ||  |      ||| |  | ||   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |       || ||  |      ||| |  ^***   |  |||| ||||  | |           
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^      ||| ^**^************^****^  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |       *****  |      |||    | |    ***********   | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |       || ||  |      |**    | |    |  | || ||    | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |       ********      | |    | |    **** *****    | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                     | |    ***                  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                         ***           

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ZINC FINGER PROTEIN 692
member of: GB:search21361766GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR11389/searchPTHR11389_SF410PFAM:searchPF00096/searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchQ9BU19
JMol viewer RasMol script viewer  ZN 401A  ..                                        *  *            *    *                
JMol viewer RasMol script viewer  ZN 201A  ..         *  *            *   *          |  |            |    |                
sec str:  .........ee......ee.hhhhhhhhhhhhhhhh....ee......ee.hhhhhhhhhhhh.................
sequence :  ..GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
seq num:  ..1         11        21        31        41        51        61        71      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |   |  | |^**  | |||||  |  |   ||| |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   |  | |     | |||||  |  |   ||| |  | ||   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | |     | |||||  |  |   ||| |  ^***   |  |||| || |  | |           
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..         ^**^************^***^  |   ||| ^**^************^****^  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |     *******  |  |   |||    | |    **********    | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |     | || ||  |  |   |**    | |    |  | |  |     | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |     **********  |   | |    | |    **** ****     | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            ***              |  |   | |    ***                  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****   ***                         ***           

   New search    2d9h:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML