triangle PDBeMotif: 2d8x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification structural protein, cell cycle    | release date: Thu, Dec 8, 2005
Title solution structure of the second lim domain of particularly interesting new cys-his protein (pinch)
Authors F.HAYASHI, GENOMICS/PROTEOMICS INITIATIVE (RSGI), RIKEN STRUCTURAL, S.YOKOYAMA, X.R.QIN
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  || | | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  || | | |  
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  || | | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     ***** | | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****| | | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      | | | |  
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | | | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             *** ***  

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||||  |||        | ^***|  | ||  | | |       |  |     |  ||     | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  ||     | |
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..  | |  ^**^****************^**^**^**^****       |  |     |  ||     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |     | |        |  |     | |   | |         |  |     *****     | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |     | |        ****     | |   | |         ****     ****      | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***     | |                 ***   | |                            | |
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                            ***

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     *****|| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****|****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      ||| |    
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      ||| |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             *****    

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |    ******        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****    *****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                               

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |||  |||        | ^***|  | ||  | | |       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 .. | |   ^**^****************^**^**^**^****       |  |     |  |||| |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |      | |        |  |     | |   | |         |  |     *****|| |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |      | |        ****     | |   | |         ****     ****|****    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |      | |                 ***   | |                      | |      
search RasMol script viewer Motif-ligand binding stats  nest .. ***      ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |    || ||||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |    || ||||| |    
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |    || ||||| |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |    ******|| |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****    *****|****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      | |      
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                               

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     ***** |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****| |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      | |      
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |||  |||        | ^***|  | ||  | | |       |  |     |  || | ||  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  || | ||  |
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 .. | |   ^**^****************^**^**^**^****       |  |     |  || | ||  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |      | |        |  |     | |   | |         |  |     ***** | ||  |
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |      | |        ****     | |   | |         ****     ****| | |****
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***      | |                 ***   | |                      | ***    
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                               

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     ***** |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****| |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      | |      
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |                  
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                               

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |||  |||        | ^***|  | ||  | | |       |  |     |  || ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  || ||     
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..   |  |^**^****************^**^**^**^****       |  |     |  || ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |   | |        |  |     | |   | |         |  |     ********     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |   | |        ****     | |   | |         ****     *******      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |   | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |   ***                       ***                               
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                                               

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  ||   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  ||   | |  
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  ||   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     *****   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****    | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                          | |  
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                          | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                 ***  

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |    || ||| | | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |    || ||| | | |  
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |    || ||| | | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |    ****** | | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****    *****| | | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      | | | |  
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | | | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             *** ***  

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  |||| | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  |||| | | |
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  |||| | | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |     *****|| | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****|**** | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                      ||| | ***
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      ||| |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             *****    

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  |  |  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  |  |  | | |       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  || |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |           | |         |  |     ***** |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****           | |         ****     ****| |      
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                             ***      

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   ||||  |||        | ^***|  | ||  | | |       |  |    || ||| |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |    || ||| |      
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..    | |^**^****************^**^**^**^****       |  |    || ||| |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |   | |        |  |     | |   | |         |  |    ****** |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |   | |        ****     | |   | |         ****    *****| |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |   | |                 ***   | |                      | |      
search RasMol script viewer Motif-ligand binding stats  nest ..    | |   ***                       ***                      | |      
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                                      ***      

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |     |  |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |     |  |  |      
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |     |  |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****     ****  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****      

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PINCH
member of: GENE3D:searchG3DSA_2.10.110.10PANTHER:searchPTHR24210/searchPTHR24210_SF8PFAM:searchPF00412PIRSF:searchPIRSF038003PROSITE PATTERNS:searchPS00478, PROSITE PROFILES:searchPS50023, SMART:searchSM00132SUPERFAMILY:searchSSF57716UniProt:searchP48059
JMol viewer RasMol script viewer  ZN 401A  ..                                 *  *                 *  *            
JMol viewer RasMol script viewer  ZN 201A  ..       *  *                *  *  |  |                 |  |            
sec str:  .....................eee..eee...................eee..eeehhhhhhhhhh......
sequence :  ..GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||  |||        | ^***|  | ||  | | |       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****|        |  |  |  | ||  | | |       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  LIM_DOMAIN_1 ..       ^**^****************^**^**^**^****       |  |    || |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |        |  |     | |   | |         |  |    ******        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |        ****     | |   | |         ****    *****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |                 ***   | |                               
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                       ***                               

   New search    2d8x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML