triangle PDBeMotif: 2d8i  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification immune system, signaling protein    | release date: Tue, Dec 6, 2005
Title solution structure of the pdz domain of t-cell lymphoma invasion and metastasis 1 varian
Authors F.HAYASHI, GENOMICS/PROTEOMICS INITIATIVE (RSGI), RIKEN STRUCTURAL, S.YOKOYAMA, X.R.QIN
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALN
SSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | |               |  |      |  |          | ||  | ||||    |        || ||^***  || ||        |  ||||    |||| 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | |               |  |      |  |          ^**|  | ^**|    |        || ||      || ||        |  ||||    |||| 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** |               ^***      ^***          ^***  |  | |    |        || ||      || ||        ^***|||    |||| 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^***** | |                                             |  | ^*****        || ||      || ||           ||||    |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |                                             |  |               *****      || ||           ||||    |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |                                             ****               *****      ****|           ||||    |||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***                                                                 |  |       |  |           ***|    |*** 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****            ***    ***  

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |             |  |      |  |          | ||    | || | ||        || ||^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |             |  |      |  |          ^**|    ^**| | ||        || ||      || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |             ^***      ^***          ^***    |  | | ||        || ||      || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | |                                        |    |  ^*****        || ||      || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |                                        |    |    | |         *****      || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |                                        |    |    | |         ****|      ****|                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                                        |    |    ***          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                                        |    |                 ****       ****                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                    ******                                                        

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |            |||||      |  |          | ||    | || | ||        || ||^***| || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |            |||||      |  |          ^**|    ^**| | ||        || |||   | || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |            |^***      ^***          ^***       | | ||        || |||   | || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | |            | ||                                ^*****        || |||   | || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |            | ||                                  | |         *****|   | *****                        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |            | ||                                  | |         || ||***** || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |            ****                                  | |         ****|      *****                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |            | |                                   ***          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..         | |            ***                                                |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                                                               ****       ****                        

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 |  |      |  ||  |      | ||    | || |  |        || ||^***  || ||        |  |  |         
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 |  |      |  ||  |      ^**|    ^**| |  |        || |||  |  || ||        |  |  |         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^***      ^***|  |      ^***       | |  |        || |||  |  || ||        ^***  |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                                 |  |                 ^*****        || |||  |  || ||           |  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                       |  |                   |  |        *****|  |  || ||           |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                       ****                   ****        *********  *****           |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                              ****         ****       ****           ****         

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|  ||| |                 |  | | |  |  |          | ||    | ||    |        || ||^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  ||| |                 |  | | |  |  |          ^**|    ^**|    |        || ||      || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  |^***                 ^*** | |  ^***          ^***       |    |        || ||      || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                        | |                           ^*****        || ||      || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |                        | |                                         *****      || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                        | |                                         *****      ****|                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***                        | |                                          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                              ***                                          ****       ****                        

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |             |  | | |  |  ||  |      | ||    | ||    |        || ||^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |             |  | | |  |  ||  |      ^**|    ^**|    |        || ||      || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |             ^*** | |  ^***|  |      ^***       |    |        || ||      || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^***** | | |                  | |      |  |                 ^*****        || ||      || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | | | |                  | |      |  |                               *****      || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | | | |                  | |      ****                               *****      ****|                        
search RasMol script viewer Motif-ligand binding stats  nest ..     *** | |                  ***                                          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                                                               ****       ****                        

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                ||| |      |  |          | ||   || ||    |         |  |^***   |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                ||| |      |  |          ^**|   |^**|    |         |  |       |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                |^***      ^***          ^***   |  ||    |         |  |       |  |        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                  | |                             |  |^*****         |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                        ***                             |  |               |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                        ****               ****       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****                        

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 |  |      |  ||  |      | ||    | || | ||        || ||^***  || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 |  |      |  ||  |      ^**|    ^**| | ||        || ||      || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^***      ^***|  |      ^***       | | ||        || ||      || ||        ^***       | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                                 |  |                 ^*****        || ||      || ||                   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                       |  |                   | |         *****      || ||                   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                       ****                   | |         *****      *****                   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                              ***          |  |       |  |                   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****                   ***  

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|| ||| |                 |  |      |  |          | ||  | |||| | ||         |  |^*** ||| ||        |  |         | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|| ||| |                 |  |      |  |          ^**|  | ^**| | ||         |  |  || ||| ||        |  |         | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|| |^***                 ^***      ^***          ^***  |  ||| | ||         |  |  || ||| ||        ^***         | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                   |  |                          |  ||^*****         |  |  || ||| ||                     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |                     |  |                          *****  | ||         |  |  *********                     | |
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |                     |  |                          ****   ****         ****  ********|                     | |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***                     |  |                                 ***|         |  |       |  |                     | |
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |                                 |  |         |  |       |  |                     ***
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                 ****         ****       ****                        

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |   | |           |  |      |  |          | ||    | ||    |         |  |^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |   | |           |  |      |  |          ^**|    ^**|    |         |  || |   || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***   | |           ^***      ^***          ^***       |    |         |  || |   || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****     | |                                              ^*****         |  || |   || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |                                                             |  || |   *****                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |                                                             |  |***   || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |                                                             |  |      *****                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           ***                                                             |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****                        

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | | |           |  | | |  |  ||  |      | ||    | || | ||        || ||^***  || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | | |           |  | | |  |  ||  |      ^**|    ^**| | ||        || ||      || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | | |           ^*** | |  ^***|  |      ^***       | | ||        || ||      || ||        ^***       | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | | |                | |      |  |                 ^*****        || ||      || ||                   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | | |                | |      |  |                   | |         *****      || ||                   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | | |                | |      ****                   | |         *****      *****                   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | ***                | |                             ***          |  |       |  |                   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                  ***                                          ****       ****                   ***  

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 |  |      |  ||  |      | ||    | || |  |        || ||^***|||||||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 |  |      |  ||  |      ^**|    ^**| |  |        || ||| |||||||||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^***      ^***|  |      ^***       | |  |        || ||| |||||||||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                                 |  |                 ^*****        || ||| |||||||||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                       |  |                   |  |        *****| |******||                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                       |  |                   |  |        || ||***||||||||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                       ****                   ****        ****|   *******|                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                              ****         ****       ****                        

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|  ||| |                 |  | | |  |  ||  |      | ||    | || |  |    |  ||| ||^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  ||| |                 |  | | |  |  ||  |      ^**|    ^**| |  |    |  ||| ||      || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  |^***                 ^*** | |  ^***|  |      ^***       | |  |    |  ||| ||      || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                   |  | | |      |  |                 ^*****    |  ||| ||      || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |                   |  | | |      |  |                   |  |    |  |*****      *****                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                   |  | | |      ****                   |  |    ********|      *****                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***                   |  | | |                             |  |         |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  | ***                             |  |         |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                 ****         ****       ****                        

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..| | || |                 |  |      |  |          | ||  | ||||    |        || ||^***|||| ||        |  |     | |    
search RasMol script viewer Motif-ligand binding stats  PS00005 ..| | || |                 |  |      |  |          ^**|  | ^**|    |        || ||| | |||| ||        |  |     | |    
search RasMol script viewer Motif-ligand binding stats  PS00006 ..| | ^***                 ^***      ^***          ^***  |  | |    |        || ||| | |||| ||        ^***     | |    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^***** |                                               |  | ^*****        || ||| | |||| ||                 | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |  | |                                               |  |               *****| *****| ||                 | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| |  | |                                               |  |               || ||*****||| ||                 | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |  | |                                               ****               *****  *********                 | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***  | |                                                                   |  |       |  |                 | |    
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                                                                   |  |       |  |                 ***    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****                        

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |             |  | | |  |  |          | ||  | |||| |  |        || ||^*** ||||||        |  |  |    | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |             |  | | |  |  |          ^**|  | ^**| |  |        || ||     ||||||        |  |  |    | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |             ^*** | |  ^***          ^***  |  ||| |  |        || ||     ||||||        ^***  |    | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | |                  | |                      |  ||^*****        || ||     ||||||           |  |    | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |                  | |                      *****  |  |        *****     ||||||           |  |    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |                  | |                      ****   ****        *****     *****|           |  |    | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  | |                             |  |         |  |       |  |           |  |    ***  
search RasMol script viewer Motif-ligand binding stats  nest ..         | |                  ***                             |  |         |  |       |  |           |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                                                  ****         ****       ****           ****         

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 || | | |  |  |          | ||    | || |  |         |  |^***  || ||        |  |       | | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 || | | |  |  |          ^**|    ^**| |  |         |  |      || ||        |  |       | | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^*** | |  ^***          ^***       | |  |         |  |      || ||        ^***       | | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                    | | | |                           ^*****         |  |      || ||                   | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          | | | |                             ****         |  |      *****                   | | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                          | | | |                             |  |         |  |       |  |                   *** |
search RasMol script viewer Motif-ligand binding stats  nest ..                          | | ***                             |  |         |  |       |  |                     ***
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***                                 ****         ****       ****                        

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |             |  | | |  |  |          | ||    | || |  |        || ||^***|||||||        |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |             |  | | |  |  |          ^**|    ^**| |  |        || ||    |||||||        |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |             ^*** | |  ^***          ^***       | |  |        || ||    |||||||        ^***  | |       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | |                  | |                           ^*****        || ||    |||||||              | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |                  | |                             |  |        *****    ******|              | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |                  | |                             ****        *****    ******|              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                  | |                             |  |         |  |       |  |              ***       
search RasMol script viewer Motif-ligand binding stats  nest ..         | |                  ***                             |  |         |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                                                  ****         ****       ****                        

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 |  |      |  |          | ||    | ||    |         |  |^***  || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 |  |      |  |          ^**|    ^**|    |         |  |      || ||        |  |       | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^***      ^***          ^***    |  |    |         |  |      || ||        ^***       | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                                              |    |  ^*****         |  |      || ||                   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                    |    |                 ****      ****|                   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                    |    |                 |  |       |  |                   ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    |    |                 ****       ****                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                    ******                                                        

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || |                 |  |      |  |          | ||    | ||    |        || ||^***| || ||        |  |  | | |     
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || |                 |  |      |  |          ^**|    ^**|    |        || |||  || || ||        |  |  | | |     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^***                 ^***      ^***          ^***       |    |        || |||  || || ||        ^***  | | |     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****                                                      ^*****        || |||  || || ||              | | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                                                          ********** *****              | | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                                          *********  ****|              | | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                                           |  |       |  |              *****     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ****       ****                        

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T-CELL LYMPHOMA INVASION AND METASTASIS 1VARIANT;
sec str:  ................eeeeeeee...........eeeeeee..eeeeeeee.....hhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeeeee...............
sequence :  ..GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   || | | |            ||||| | |  |  ||  |      | ||    | || | ||        || ||^***  || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   || | | |            ||||| | |  |  ||  |      ^**|    ^**| | ||        || ||| |   || ||        |  |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|   ^*** | |            |^*** | |  ^***|  |      ^***       | | ||        || ||| |   || ||        ^***            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..^*****   | |            ||||| | |      |  |                 ^*****        || ||| |   || ||                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |            ||||| | |      |  |                   | |         *****| |   || ||                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |            ||||| | |      |  |                   | |         || ||***   || ||                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |            ||||| | |      ****                   | |         *****      ****|                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |            ||||| | |                             ***          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..         | |            ****| ***                                          |  |       |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..         ***              ***                                              ****       ****                        

   New search    2d8i:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML