triangle PDBeMotif: 2d2w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification dna binding protein    | release date: Mon, Sep 19, 2005
Title solution structure and dynamics of the dna-binding domain of myocyte nuclear factor
Authors C.-H.CHANG, W.-J.CHUANG, W.-Y.JENG, Y.-P.CHU
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRID
PASEAKLVEQAFRKRRQRGVS
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   | | |  || | |         || ||||^***|  |     |  |               | || |  | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   | | |  || | |         || ^**|||  |  |     |  |               | || |  | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   | | |  || | |         || || |||  |  |     ^***               | || |  | |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  ************** ||     | | |  || | |         || || |||  |  |                        | || |  | |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  || ||     | | |  || | |         *******||  |  |                        | || |  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  *****     | | ***** | |         || |*****  |  |                        | || |  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     | | ******* |         ********|  |  |                        ******  | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        | |       | |                 |  |  |                                ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                        | |       ***                 *******                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                          

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   | |||       |  |      |  ||||^***|  |    ||| |          | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   | |||       |  |      |  ^**| |  |  |    ||| |          | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   | |||       |  |      |  || | |  |  |    |^***          | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     | |||       |  |      |  || | |  |  |    | |            | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     | |||       |  |      ******* |  |  |    | |            | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     | |||       |  |      *****   |  |  |    | |            | || | ||||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ****|       |  |      ****    |  |  |    | |            ************|        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        | | |       |  |              |  |  |    ***                     |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                        | | |       ****              *******                            ****        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                          

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || | | | |||  |  | |         |  ||||^***|        |  |          |  |   ||||||    | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || | | | |||  |  | |         |  ^**||| ||        |  |          |  |   ||||||    | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^*** | | |||  |  | |         |  || ||| ||        ^***          |  |   ||||||    | | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  | | | | |||  |  | |         |  || ||| ||                      |  |   ||||||    | | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  | | | | |||  |  | |         *******|| ||                      |  |   ||||||    | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  ||  | | | | |||  |  | |         ********* ||                      |  |   ******    | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ******** | | ****|  **** |         ***********|                      ****   *****|    | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  | | | | | |     | |                 |  |                               |  |    *** 
search RasMol script viewer Motif-ligand binding stats  niche ..               **** *** | | |     ***                 ****                               ****        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                          

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  ||  | |  |        || |||||^***|  |   | || | |          |  | |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  ||  | |  |        || |^**|||  |  |   | || | |          |  | |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  ||  | |  |        || | | |||  |  |   | ^*** |          |  | |  ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  | |  |        || | | |||  |  |   |  | | |          |  | |  ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  ||  | |  |        |*******||  |  |   |  | | |          |  | |  ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  ||  |     |  ||  | |  |        |  | |  ||  |  |   |  | | |          |  | *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ******** |  |        **** ****|  |  |   |  | | |          **** ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 |  |                 |  |  |   |  | ***                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ****                 *******   ******                               

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |            |  |         || ||||^***|        |  |                 |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |            |  |         || ^**|||  |        |  |                 |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***            |  |         ||  |||||  |        ^***                 |  ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |              |  |         ||  |||||  |                             |  ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |              |  |         *******||  |                             |  ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |              |  |          |  *****  |                             *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********              ****          ********  |                             ****          
search RasMol script viewer Motif-ligand binding stats  niche ..               ****              ****                 ****                                           

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  ||  | |  |         || ||||^***|  |     | || |               | ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  ||  | |  |         || ^**|||  |  |     | || |               | ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  ||  | |  |         ||  | |||  |  |     ^*** |               | ||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  | |  |         ||  | |||  |  |       |  |               | ||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  ||  | |  |         *******||  |  |       |  |               | ||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     |  ||  | |  |          |  *****  |  |       |  |               *****|        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ******** ****          *******|  |  |       |  |               **** |        
search RasMol script viewer Motif-ligand binding stats  niche ..               ****              ****                 *******       ****                 ****        

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |       || ||| || |   |  |   | ||||         || ||||^***| |||    |  |               | || |||    | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |       || ||| || |   |  |   | ||||         || ^**|||  | |||    |  |               | || |||    | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |       || ||| ^***   |  |   | ||||         ||  | |||  | |||    ^***               | || |||    | | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  |   | ||||         ||  | |||  | |||                       | || |||    | | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..          || |||  |     |  |   | ||||         *******||  | |||                       | || |||    | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****|  |     |  |   *****|          |  *****  | |||                       | *****|    | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          *********     ****   **** |          *******|  | |||                       ****** |    | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |              |  |                 |  | ***                            | |    | | 
search RasMol script viewer Motif-ligand binding stats  niche ..               ****              ****                 *******                             ***    *** 

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  |   | ||||  |      || ||||^***|        |  | |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  |   | ||||  |      || ^**|||  |        |  | |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  |   | ||||  |      ||  |||||  |        ^*** |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  |   | ||||  |      ||  |||||  |           | |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  |   | ||||  |      *******||  |           | |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     |  |   *****|  |       |  || ||  |           | |               |  |  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ****   ******  |       ********  |           | |               ****  | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 |  |  |              |  |           | |                     ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                                 *******              ****           ***                             

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |   | |  |  || || | | |  ||  ||  || | |     || ||||^***|  |     |  |          |  |   | ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | |  |  || || | | |  ||  ||  || | |     || ^**|||  |  |     |  |          |  |   | ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | |  |  || ^*** | |  ||  ||  || | |     ||  | |||  |  |     ^***          |  |   | ||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  | | | |  ||  ||  || | |     ||  | |||  |  |                   |  |   | ||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..      | |  |  ||  | | | |  ||  ||  || | |     *******||  |  |                   |  |   | ||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  *****  | | | |  ||  |***** | |      |  |  ||  |  |                   |  |   *****|        
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  ******** | | ************  | |      *******|  |  |                   ****   **** |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***      |  | | |               ***             |  |  |                            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..               ********                               *******                            ****        

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |     |  || || |   |  |    || ||| || || ||| ||||^***|  |   | || |            |  |||| |   | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |     |  || || |   |  |    || ||| || || ||| ^**||   |  |   | || |            |  |||| |   | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || |     |  || ^***   |  |    || ||| || || ||| || ||   |  |   | ^***            |  |||| |   | |    
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  |    || ||| || || ||| || ||   |  |   | || |            |  |||| |   | |    
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..   | |     |  ||  |     |  |    || ||| || || |*******|   |  |   | || |            |  |||| |   | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     *****  |     |  |    || ||| || || |*****  |   |  |   | || |            *****|| |   | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     ********     ****    ****|| || || |********   |  |   | || |            *********   | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |                           |  || || |***           |  |   ***| |                        | |    
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                           **********              ****      ***                        ***    

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  ||  | |  |         |  ||||^***|  |     | ||            |  | ||||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  ||  | |  |         |  ^**|||  |  |     | ||            |  | ||||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  ||  | |  |         |   | |||  |  |     ^***            |  | ||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  | |  |         |   | |||  |  |     | |             |  | ||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  ||  | |  |         *******||  |  |     | |             |  | ||||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     |  ||  | |  |             |  ||  |  |     | |             |  | *****|        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ******** ****             ****|  |  |     | |             ********* |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |              |  |                 |  |  |     ***                    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..               ****              ****                 *******                            ****        

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |   | |  |  || || |   | |||           | |   |  ||||^***|  |     |  |                 |  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | |  |  || || |   | |||           | |   |  ^**||||||  |     |  |                 |  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | |  |  || ^***   | |||           | |   |   ||||||||  |     ^***                 |  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     | |||           | |   |   ||||||||  |                          |  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..      | |  |  ||  |     | |||           | |   *******|||||  |                          |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  *****  |     | |||           | |       *******|  |                          |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  ********     ****|           | |       ****** |  |                          ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***               | | |           | |        |   | |  |                                        
search RasMol script viewer Motif-ligand binding stats  niche ..                        | | |           ***        |   | ****                                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****                      |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        | |                        *****                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                          

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   | |||  |              || ||||^***|        || |          |  | | || ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   | |||  |              || ^**|||  |        || |          |  | | || ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   | |||  |              ||  |||||  |        ^***          |  | | || ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     | |||  |              ||  |||||  |         | |          |  | | || ||         
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     | |||  |              *******||  |         | |          |  | | || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     | |||  |               |  *****  |         | |          |  | | *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ********               ********  |         | |          **** ******          
search RasMol script viewer Motif-ligand binding stats  niche ..               ****     | | |                         ****         ***                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                          

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || | | |  ||  ||  ||      | ||| ||||^***|  |     |  | |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || | | |  ||  ||  ||      | ||| ^**||   |  |     |  | |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^*** | |  ||  ||  ||      | |||  | ||   |  |     ^*** |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  | | | |  ||  ||  ||      | |||  | ||   |  |        | |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  | | | |  ||  ||  ||      | |*******|   |  |        | |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  ||  | | | |  ||  |*****      | | |  |  |   |  |        | |          |  | |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ******** | | ************       | | *******   |  |        | |          **** ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  | ***                    ***           |  |        ***                             
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                                      ****                                        

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |       |  | |  |         |  ||||^***|  |     |  | |          |  ||||||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |       |  | |  |         |  ^**|||  |  |     |  | |          |  ||||||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***       |  | |  |         |   | |||  |  |     ^*** |          |  ||||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |         |  | |  |         |   | |||  |  |        | |          |  ||||||||        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |         |  | |  |         *******||  |  |        | |          |  ||||||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |         |  | |  |             *****  |  |        | |          |  |******|        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********         **** |  |             ****|  |  |        | |          ********* |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |              |  |                 |  |  |        ***                 |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..               ****              ****                 *******                            ****        

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |     |  || || |   |  ||  | |||| | |     |  ||||^***|  |     |  |               | |||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |     |  || || |   |  ||  | |||| | |     |  ^**|||  |  |     |  |               | |||| |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || |     |  || ^***   |  ||  | |||| | |     |   | |||  |  |     ^***               | |||| |        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  | |||| | |     |   | |||  |  |                        | |||| |        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..   | |     |  ||  |     |  ||  | |||| | |     *******||  |  |                        | |||| |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     *****  |     |  ||  *****| | |         *****  |  |                        | |||| |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     ********     *********** | | |         ****|  ****                        ****** |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |                           |  | ***             |  |  |                            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                           ****                 *******                            ****        

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  ||  |    |  |   | ||  ||||^***|  |     |  |    | |        | || |||| |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  ||  |    |  |   | ||  ^**|||  |  |     |  |    | |        | || |||| |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  ||  |    |  |   | ||   | |||  |  |     ^***    | |        | || |||| |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  |    |  |   | ||   | |||  |  |             | |        | || |||| |     
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  ||  |    |  |   | |*******||  |  |             | |        | || |||| |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  ||  |     |  ||  |    |  |   | |    *****  |  |             | |        | *****|| |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ********    |  |   | |    ****|  |  |             | |        ****** || |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |                 |  |   ***        |  |  |             ***             | |***     
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                 ****              *******                             ***        

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || |||||  |  |    |  ||   | |   || ||||^***|  |     |  |                    | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || |||||  |  |    |  ||   | |   || ^**|||  |  |     |  |                    | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***|  |  |    |  ||   | |   ||  | |||  |  |     ^***                    | |        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  ||||  |  |    |  ||   | |   ||  | |||  |  |                             | |        
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  ||||  |  |    |  ||   | |   *******||  |  |                             | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  ||||  |  |    *****   | |    |  *****  |  |                             | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********|||  ****    ****    | |    *******   |  |                             | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |  |***                  | |              |  |                             | |        
search RasMol script viewer Motif-ligand binding stats  niche ..               ******                   ***              ****                             ***        

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || |   |  ||  |              |  ||||^***| |||    |  |          | || |||||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || |   |  ||  |              |  ^**|||  | |||    |  |          | || |||||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^***   |  ||  |              |  || |||  | |||    ^***          | || |||||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  |     |  ||  |              |  || |||  | |||                  | || |||||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  |     |  ||  |              *******||  | |||                  | || |||||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****  |     |  ||  |              *********  | |||                  | *****|||| |   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ********     ********              ********   | |||                  *********** |   |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                         | ***                           |  |   |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         ****                            ****   **** 

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN K1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF107PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchP42128
sec str:  ..........hhhhhhhhhhh...ee...hhhhhhhhhh........hhhhhhhhhhhhh...ee.............ee.......hhhhhhh.........
sequence :  ..ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
seq num:  ..1         11        21        31        41        51        61        71        81        91         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        |  || || | | |  ||  || ||    | |   || ||||^***|  |     |  |            |  |||  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        |  || || | | |  ||  || ||    | |   || ^**|||  |  |     |  |            |  |||  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        |  || ^*** | |  ||  || ||    | |   ||  | |||  |  |     ^***            |  |||  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  | | | |  ||  || ||    | |   ||  | |||  |  |                     |  |||  |          
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..           |  ||  | | | |  ||  || ||    | |   *******||  |  |                     |  |||  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  ||  | | | |  |********    | |    |  *****  |  |                     *****|  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ******** | | ***********     | |    *******|  |  |                     **** ****          
search RasMol script viewer Motif-ligand binding stats  niche ..               **** ***                 ***           *******                                        

   New search    2d2w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML