triangle PDBeMotif: 2ct3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification signaling protein    | release date: Mon, May 23, 2005
Title solution structure of the sh3 domain of the vinexin protein
Authors K.MIYAMOTO, M.INOUE, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI), S.KOSHIBA, S.YOKOYAMA, T.KIGAWA, T.TOMIZAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |  |   |  |    ||          ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |  |   |  |    ||             | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..                   |  |   |  |    **             | |    || ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ****   ****                   | |    ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |                   ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****                           ****         

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                    |  |         | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |         | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  |         | |       | |    *****         
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****         

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |   |  |    ||   | |    ^**^** |  ||||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |   |  |    ||   | |       | | ^*****|| |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                    | |   |  |    **   | |       | |    || || |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |   ****         | |       | |    ****| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   |  |         ***       ***     |  | |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ****                           **** ****    

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |                    |  |    || |  |     ^**^** |  |||||    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |    || |  |        | | ^*****||    | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |                    |  |    ** |  |        | |    || ||    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                    |  |       ****        | |    *****    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                    |  |                   ***     |  |    | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****    ***  

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | |             |  |   |  |         | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |  |   |  |         | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |               |  |   |  |         | |       | |    ****|         
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***               |  |   |  |         | |       | |     |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****                           ****         

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |   |  |       | |||    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |   |  |       | |||       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |   |  |       ****|       | |    *****         
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ****                           ****         

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |  |                    |  |         | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |         | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |                       |  |         | |       | |    *****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                       |  |         | |       | |     |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****         

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                    |  |         | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |         | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  |         | |       | |    ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****         

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |   |  |       | |||    ^**^** |  |||||      | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |   |  |       | |||       | | ^*****||      | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                    | |   |  |       *****       | |    || ||      | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |   |  |       ****|       | |    ****|      | |
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   |  |         ***       ***     |  |      ***
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ****                           ****         

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |                    |  |         | |    ^**^** |  |||||    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |         | |       | | ^*****||    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                    |  |         | |       | |    ****|    | |  
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                    |  |         ***       ***     |  |    | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****    ***  

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |   |  |    ||   | |    ^**^** |  |||||  | | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |   |  |    ||   | |       | | ^*****||  | | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                    | |   |  |    **   | |       | |    || ||  | | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |   |  |         | |       | |    *****  | | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   |  |         ***       ***     |  |  | | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ****                           ****  *****  

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |  |   |  |    ||   | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |  |   |  |    ||   | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..                   |  |   |  |    **   | |       | |    || ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |  |   |  |         | |       | |    ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****                           ****         

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||                   |  |         | |    ^**^** |  ||||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|                   |  |         | |       | | ^*****|| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |                   |  |         | |       | |    ****| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..    | |                   |  |         ***       ***     |  | |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                   ****                           **** ****    

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                    |  |         | |    ^**^** |  ||||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |         | |       | | ^*****|| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  |         | |       | |    ****| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |         ***       ***     |  | |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           **** ****    

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |  |   |  |         | |    ^**^** |  |||||     | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |  |   |  |         | |       | | ^*****||     | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |  |   |  |         | |       | |    ****|     | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  |   |  |         | |       | |     |  |     *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****                           ****         

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |   |  |         | |    ^**^** |  ||||| |  |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |   |  |         | |       | | ^*****|| |  |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |   |  |         | |       | |    ****| |  |||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |   |  |         | |       | |     |  | |  ***| 
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   |  |         ***       ***     |  | |  || | 
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ****                           **** ******* 

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                    |  |    ||   | |    ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |    ||   | |       | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..                          |  |    **   | |       | |    || ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  |         | |       | |    ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |         ***       ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                           ****         

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             |  |   |  |       |  |     ^**^** |  |||||    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             |  |   |  |       |  |        | | ^*****||    | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |  |   ****       ****        | |    ****|    | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  |   |  |                   | |     |  |    ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |                   ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****                           ****         

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                    |  |   | |          ^**^** |  |||||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                    |  |   | |             | | ^*****||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  |   | |             | |    *****         
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |   | |             ***     |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****   ***                     ****         

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINEXIN
member of: GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10661/searchPTHR10661_SF68PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchO60504
sec str:  .........eeeee.................eeeeeeee....eeeeee.....eeeeehhheee.......
sequence :  ..GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
seq num:  ..1         11        21        31        41        51        61        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||            |  |   |  |   | |   | |    ^**^** |  ||||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|            |  |   |  |   | |   | |       | | ^*****|| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |            |  |   |  |   | |   | |       | |    ****| |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***            |  |   |  |   | |   | |       | |     |  | |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   |  |   | |   ***       ***     |  | |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ****   ***                     **** ****    

   New search    2ct3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML