triangle PDBeMotif: 2cry  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification immune system    | release date: Fri, May 20, 2005
Title solution structure of the fifth ig-like domain of human kin of irre like 3
Authors C.KUROSAKI, F.HAYASHI, GENOMICS/PROTEOMICS INITIATIVE (RSGI), M.YOSHIDA, RIKEN STRUCTURAL, S.YOKOYAMA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTI
SNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |                   | |  |    |            | |||      | |      || ||    |     || || |  ^***     |  |       | |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |                   | |  |    |            ^**||      ^**      || ||    |     || || |           |  |       | |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |                   | |  |    |            ^***|               ^***|    |     || || |           ^***       | |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                   | |  ^*****              | |                |  ^*****     || || |                      ^*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                   | |                      | |                ****          *******                      | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***                   ***                      | |                                 |  |                      | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |                                 |  |                      ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                        |    |       ||   | |||      | |      |  ||    |     |  |  |  ^***     |  | | |   |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                        |    |       ||   ^**||      ^**      |  ||    |     |  |  |           |  | | |   |    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                        |    |       ||   ^***|               ^***|    |     |  |  |           ^*** | |   |    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                        ^*****       ||     | |                   ^*****     |  |  |                | |   ^***** |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                           **     | |                              |  |  |                | |        | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                  | |                              ****  |                | |        | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                  | |                                 |  |                ***        | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                           ***  

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |               | | | | |||   |       ||   | |||      | |      || ||    |     | || ||  ^***     |  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |               | | | | |||   |       ||   ^**||      ^**      || ||    |     | || ||           |  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |               | | | | |||   |       ||   ^***|               ^***|    |     | || ||           ^***       |    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****               | | | | |^*****       ||     | |                |  ^*****     | || ||                      ^***** |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | | | | |           ||     | |                |  |          | *****                           | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | | | | | |           **     | |                |  |          | || ||                           | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | | | | | |                  | |                ****          ******|                           | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | | *** ***                  | |                                 |  |                           ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                     ***                          | |                                 |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |                   | | |||   |       ||   | |||      | |      || ||    |     || || |  ^***     |  |  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | |                   | | |||   |       ||   ^**||      ^**      || ||    |     || || |           |  |  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| | |                   | | |||   |       ||   ^***|               ^***|    |     || || |           ^***  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                   | | |^*****       ||     | |                |  ^*****     || || |                 | |  ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |                     | | | |           **     | |                |  |          || || |                 | |            
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |                     | | | |                  | |                ****          ***** |                 | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |                     *** ***                  | |                                 |  |                 ***            
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                              | |                                 |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                      ||||   || |    ||   | |||      | ||     |  ||    |     |||||||  ^***     |  |       | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                      ||||   || |    ||   ^**||      ^**|     |  ||    |     |||||||           |  |       | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                      ||||   || |    ||   ^***|      |  |     ^***|    |     |||||||           ^***       | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                      ||^*****| |    ||     | |      |  |         ^*****     |||||||                      ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                            ||||    | |    ||     | |      |  |                    ||*****                        | |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                            ||||    | |    **     | |      |  |                    |||||||                        | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            ||||    | |           | |      ****                    ******|                        | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                            ****    | |           | |                                 |  |                        ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                 ****                                

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                        |    |       ||   | |||      | |      |  ||    |     |  |  |  ^***     |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                        |    |       ||   ^**||      ^**      |  ||    |     |  |  |           |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                        |    |       ||   ^***|               ^***|    |     |  |  |           ^***       |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                        ^*****       ||     | |                   ^*****     |  |  |                      ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                           **     | |                              |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                  | |                              ****  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |||                      ||||  || |    ||   | |||      | |      |  ||    |     |||||||  ^***     |  |       |    || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||                      ||||  || |    ||   ^**||      ^**      |  ||    |     |||||||           |  |       |    || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |||                      ||||  || |    ||   ^***|               ^***|    |     |||||||           ^***       |    || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|                      |^*****| |    ||     | |                   ^*****     |||||||                      ^*****| | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |                      ||||   | |    ||     | |                              ||*****                            | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |                      ||||   | |    **     | |                              |||||||                            | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |                      ||||   | |           | |                              ******|                            | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***                      ****   | |           | |                                 |  |                            | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                 ****                            *** 

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                | |    |||   |       ||   | |||      | ||     |  ||    |     |  |  |  ^***     |  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                | |    |||   |       ||   ^**||      ^**|     |  ||    |     |  |  |           |  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                | |    |||   |       ||   ^***|      | ||     ^***|    |     |  |  |           ^***       |    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                | |    |^*****       ||     | |      | ||         ^*****     |  |  |                      ^***** |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                      | |    | |           **     | |      | ||                    |  |  |                           | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      | |    | |                  | |      ****                    ****  |                           | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                      ***    ***                  | |      ***                        |  |                           | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                           ***  

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                       |||   |       ||   | |||      | |      |  ||    |     |  |  |  ^***     |  |  | |  |||| |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                       |||   |       ||   ^**||      ^**      |  ||    |     |  |  |           |  |  | |  |||| |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                       |||   |       ||   ^***|               ^***|    |     |  |  |           ^***  | |  |||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                       |^*****       ||     | |                   ^*****     |  |  |                 | |  ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             | |           **     | |                              |  |  |                 | |  ||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             | |                  | |                              ****  |                 | |  ||||      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ***                  | |                                 |  |                 | |  ||||      
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |                                 |  |                 | |  ***|      
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                 ***   ***      

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                       |||   || |    ||   | |||      | ||     |  ||    |     |  |  |  ^***     |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                       |||   || |    ||   ^**||      ^**|     |  ||    |     |  |  |           |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                       |||   || |    ||   ^***|      | ||     ^***|    |     |  |  |           ^***       |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                       |^*****| |    ||     | |      | ||         ^*****     |  |  |                      ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             | |    | |    **     | |      | ||                    |  |  |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             | |    | |           | |      ****                    ****  |                                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ***    | |           | |      ***                        |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                 ****                                

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                       |||   |            | |||      | ||     |  ||    |        |  |  ^***     |  |       |  | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                       |||   |            ^**||      ^**|     |  ||    |        |  |           |  |       |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                       |||   |            ^***|      |  |     ^***|    |        |  |           ^***       |  | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                       |^*****              | |      |  |         ^*****        |  |                      ^*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             | |                  | |      ****                       |  |                         | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             ***                  | |                                 |  |                         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  | |                                 |  |                         ***    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                 | |   |||   |       ||   | |||      | ||     |  ||    |       || ||  ^*** |  ||  |       |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                 | |   |||   |       ||   ^**||      ^**|     |  ||    |       || ||       |  ||  |       |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                 | |   |||   |       ||   ^***|      |  |     ^***|    |       || ||       |  |^***       |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                 | |   |^*****       ||     | |      |  |         ^*****       || ||       |  |           ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | |   | |           ||     | |      |  |                      *****       |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                       | |   | |           **     | |      |  |                      || ||       |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |   | |                  | |      |  |                      *****       ****                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       | |   ***                  | |      |  |                       |  |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***                        | |      |  |                       |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***      ****                       ****                                

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||             | || |     |    || |    ||   | |||      | |      || ||    |      | || |  ^*** |  ||  |       ||||||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | ||             | || |     |    || |    ||   ^**||      ^**      || ||    |      | || |       |  ||  |       ||||||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||             | || |     |    || |    ||   ^***|               ^***|    |      | || |       |  |^***       ||||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | || |     ^*****| |    ||     | |                |  ^*****      | || |       |  |           ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |              | || |           | |    **     | |                |  |           | || |       |  |            ||||     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |              | || |           | |           | |                ****           **** |       ****            ||||     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***              ******           | |           | |                                 |  |                       ||||     
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |           | |                                 |  |                       ****     
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                 ****                                

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |               | |      |    |       ||   | |||      | |      |  ||    |        |  |  ^***     |  |    | ||    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |               | |      |    |       ||   ^**||      ^**      |  ||    |        |  |           |  |    | ||    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |               | |      |    |       ||   ^***|      | |      ^***|    |        |  |           ^***    | ||    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****               | |      ^*****       ||     | |      | |          ^*****        |  |                   | |^***** |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |               | |                   **     | |      | |                        |  |                   | |     | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |               | |                          | |      | |                        ****                   | |     | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |               | |                          | |      ***                        |  |                   ***     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..   | |               ***                          | |                                 |  |                           | |  
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                                            ***                                 ****                           ***  

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |              | |       |    || |    ||   | |||      | |      || ||    |     |||||||  ^***     |  |       | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |       |    || |    ||   ^**||      ^**      || ||    |     |||||||           |  |       | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |              | |       |    || |    ||   ^***|      | |      ^***|    |     |||||||           ^***       | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |       ^*****| |    ||     | |      | |       |  ^*****     |||||||                      ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    | |             | |    ||     | |      | |       |  |          |*****|                        | |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                    | |             | |    **     | |      | |       |  |          ||||| |                        | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |             | |           | |      | |       ****          ***** |                        | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |             | |           | |      ***                       ||  |                        | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                    ***             | |           | |                                ||  |                        | |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                |****                        ***     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                     *****                                

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |             | |        |    |       ||   | |||      | |      || ||    |      | ||||  ^***     |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             | |        |    |       ||   ^**||      ^**      || ||    |      | ||||           |  |       |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |             | |        |    |       ||   ^***|               ^***|    |      | ||||           ^***       |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | |        ^*****       ||     | |                |  ^*****      | ||||                      ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | |                     ||     | |                |  |           *****|                                
search RasMol script viewer Motif-ligand binding stats  betabulge ..                   | |                     **     | |                |  |           | || |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |                            | |                ****           **** |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                            | |                                 |  |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                                

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                        |    || |    ||   | |||      | |      |  ||    |      | || |  ^***     |  |       |  | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                        |    || |    ||   ^**||      ^**      |  ||    |      | || |           |  |       |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |                        |    || |    ||   ^***|               ^***|    |      | || |           ^***       |  | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                        ^*****| |    ||     | |                   ^*****      | || |                      ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                    | |    **     | |                               | || |                         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                    | |           | |                               **** |                         | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |           | |                                 |  |                         ***    
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***           ***                                 ****                                

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |               | |      |    |       ||   | |||      | |      || ||    |     |  |  |  ^***     |  |  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |               | |      |    |       ||   ^**||      ^**      || ||    |     |  |  |           |  |  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |               | |      |    |       ||   ^***|               ^***|    |     |  |  |           ^***  | |  |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****               | |      ^*****       ||     | |                |  ^*****     |  |  |                 | |  ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |                   **     | |                |  |          |  |  |                 | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |                          | |                ****          ****  |                 | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | |                          | |                                 |  |                 ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***                          ***                                 ****                                

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |             | |       |||   |       ||   | |||      | ||     || ||    |      | ||||  ^*** |  ||  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |             | |       |||   |       ||   ^**||      ^**|     || ||    |      | ||||       |  ||  |       |    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |             | |       |||   |       ||   ^***|      |  |     ^***|    |      | ||||       |  |^***       |    | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | |       |^*****       ||     | |      |  |      |  ^*****      | ||||       |  |           ^***** |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   | |       | |           ||     | |      |  |      |  |           *****|       |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                   | |       | |           **     | |      |  |      |  |           | || |       |  |                | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |       | |                  | |      ****      ****           ******       ****                | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | |       ***                  | |                                 |  |                           | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                   ***                            ***                                 ****                           ***  

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : KIN OF IRRE-LIKE PROTEIN 3
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11640/searchPTHR11640_SF49PFAM:searchPF07679PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8IZU9
sec str:  ..................eeee..............eee.......eeeee....ee..eee..eeeeeeee..eeeeeee....hhhhhhh.eeeeee....eeeeee...............
sequence :  ..GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |             | |        |    |       ||   | |||      | |      || ||    |      ||||||  ^***     |  |     | | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | |             | |        |    |       ||   ^**||      ^**      || ||    |      ||||||           |  |     | | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| | |             | |        |    |       ||   ^***|               ^***|    |      ||||||           ^***     | | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****             | |        ^*****       ||     | |                |  ^*****      ||||||                    | ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |               | |                     ||     | |                |  |           |*****                    | | | |     
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |               | |                     **     | |                |  |           ||||||                    | | | |     
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |               | |                            | |                ****           *****|                    | | | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |               | |                            | |                                 |  |                    | | ***     
search RasMol script viewer Motif-ligand binding stats  nest .. ***               ***                            | |                                 |  |                    | |         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ***                                 ****                    ***         

   New search    2cry:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML